PPHLN1 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-94375

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all PPHLN1 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 195-255 of human PPHLN1 (NP_958846.1). KSDESNLPEISEYEAGSTAPLFTDQPEEPESNTTHGIELFEDSQLTTRSKAIASKTKEIEQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PPHLN1 Antibody - Azide and BSA Free

Western Blot: PPHLN1 AntibodyAzide and BSA Free [NBP2-94375]

Western Blot: PPHLN1 AntibodyAzide and BSA Free [NBP2-94375]

Western Blot: PPHLN1 Antibody [NBP2-94375] - Analysis of extracts of various cell lines, using PPHLN1 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Applications for PPHLN1 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PPHLN1

PPHLN1 is encoded by this gene is one of the several proteins that become sequentially incorporated into the cornified cell envelope during the terminal differentiation of keratinocyte at the outer layers of epidermis. This protein interacts with periplakin, which is known as a precursor of the cornified cell envelope. The cellular localization pattern and insolubility of this protein suggest that it may play a role in epithelial differentiation and contribute to epidermal integrity and barrier formation. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq]

Alternate Names

Gastric cancer antigen Ga50, HSPC232, MGC48786, periphilin 1, periphilin-1

Gene Symbol

PPHLN1

Additional PPHLN1 Products

Product Documents for PPHLN1 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PPHLN1 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for PPHLN1 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review PPHLN1 Antibody - Azide and BSA Free and earn rewards!

Have you used PPHLN1 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies