PPP2R2A Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09947

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all PPP2R2A Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human 2ABA. Peptide sequence SERDKRPEGYNLKEEDGRYRDPTTVTTLRVPVFRPMDLMVEASPRRIFAN

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

49 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PPP2R2A Antibody - BSA Free

Western Blot: PPP2R2A Antibody [NBP3-09947]

Western Blot: PPP2R2A Antibody [NBP3-09947]

Western Blot: PPP2R2A Antibody [NBP3-09947] - Western blot analysis of PPP2R2A in Hela Whole Cell lysates. Antibody dilution at 1.0ug/ml

Applications for PPP2R2A Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PPP2R2A

The product of the PPP2R2A gene belongs to the phosphatase 2 regulatory subunit B family. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes an alpha isoform of the regulatory subunit B55 subfamily. (provided by RefSeq)

Alternate Names

B55A, B55ALPHA, DKFZp686N05117, FLJ26613, FLJ41727, MGC52248, PP2A subunit B isoform alpha, PP2A subunit B isoform B55-alpha, PP2A subunit B isoform PR55-alpha, PP2A subunit B isoform R2-alpha, PR52A, PR55A, protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), alphaisoform, protein phosphatase 2 (formerly 2A), regulatory subunit B (PR52), alpha isoform, protein phosphatase 2 (formerly 2A), regulatory subunit B, alpha isoform, protein phosphatase 2, regulatory subunit B, alpha, serine/threonine protein phosphatase 2A, 55 KDA regulatory subunit B, alphaisoform, serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alphaisoform

Gene Symbol

PPP2R2A

Additional PPP2R2A Products

Product Documents for PPP2R2A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PPP2R2A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PPP2R2A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PPP2R2A Antibody - BSA Free and earn rewards!

Have you used PPP2R2A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies