PPP2R5E Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-74173
Loading...
Key Product Details
Species Reactivity
Mouse
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Synthetic peptides corresponding to the N terminal of Ppp2r5e. Immunizing peptide sequence SCNIFRTLPPSDSNEFDPEEDEPTLEASWPHLQLVYEFFIRFLESQEFQP. The peptide sequence for this immunogen was taken from within the described region.
Specificity
This product is specific to Subunit or Isoform: epsilon isoform.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for PPP2R5E Antibody - BSA Free
Western Blot: PPP2R5E Antibody [NBP1-74173]
Western Blot: PPP2R5E Antibody [NBP1-74173] - Mouse Spleen lysate, concentration 1 ug/ml.Applications for PPP2R5E Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: PPP2R5E
Long Name
Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform
Alternate Names
epsilon isoform of regulatory subunit B56, protein phosphatase 2A, PP2A B subunit isoform B56-epsilon, PP2A B subunit isoform B'-epsilon, PP2A B subunit isoform PR61-epsilon, PP2A B subunit isoform R5-epsilon, PP2A, B subunit, B' epsilon, PP2A, B subunit, B56 epsilon, PP2A, B subunit, PR61 epsilon, PP2A, B subunit, R5 epsilon, protein phosphatase 2, regulatory subunit B (B56), epsilon isoform, protein phosphatase 2, regulatory subunit B', epsilon isoform, serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, epsilon, serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilonisoform
Gene Symbol
PPP2R5E
UniProt
Additional PPP2R5E Products
Product Documents for PPP2R5E Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for PPP2R5E Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for PPP2R5E Antibody - BSA Free
There are currently no reviews for this product. Be the first to review PPP2R5E Antibody - BSA Free and earn rewards!
Have you used PPP2R5E Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...