PRMT6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-32459

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (91%), Rat (95%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PRMT6 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: WKQALLYLNEPVQVEQDTDVSGEITLLPSRDNPRRLRVLLRYKVGDQEEKTKDFAME

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PRMT6 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: PRMT6 Antibody [NBP2-32459]

Immunocytochemistry/ Immunofluorescence: PRMT6 Antibody [NBP2-32459]

Immunocytochemistry/Immunofluorescence: PRMT6 Antibody [NBP2-32459] - Staining of human cell line MCF7 shows localization to nucleus & nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PRMT6 Antibody [NBP2-32459]

Immunohistochemistry-Paraffin: PRMT6 Antibody [NBP2-32459]

Immunohistochemistry-Paraffin: PRMT6 Antibody [NBP2-32459] - Staining of human testis shows strong nuclear positivity in Leydig cells.
Immunohistochemistry-Paraffin: PRMT6 Antibody [NBP2-32459]

Immunohistochemistry-Paraffin: PRMT6 Antibody [NBP2-32459]

Immunohistochemistry-Paraffin: PRMT6 Antibody [NBP2-32459] - Staining of human kidney shows strong nuclear positivity in cells in tubules.
Immunohistochemistry-Paraffin: PRMT6 Antibody [NBP2-32459]

Immunohistochemistry-Paraffin: PRMT6 Antibody [NBP2-32459]

Immunohistochemistry-Paraffin: PRMT6 Antibody [NBP2-32459] - Staining of human pancreas shows strong nuclear positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: PRMT6 Antibody [NBP2-32459]

Immunohistochemistry-Paraffin: PRMT6 Antibody [NBP2-32459]

Immunohistochemistry-Paraffin: PRMT6 Antibody [NBP2-32459] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Applications for PRMT6 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PRMT6

PRMT6 severely impairs the function of HIV-1 Rev. PRMT6 is a protein arginine N-methyltransferase, and catalyzes the sequential transfer of a methyl group from S-adenosyl-L-methionine to the side chain nitrogens of arginine residues within proteins to form methylated arginine derivatives and S-adenosyl-L-homocysteine. Protein arginine methylation is a prevalent post-translational modification in eukaryotic cells that has been implicated in signal transduction, the metabolism of nascent pre-RNA, and the transcriptional activation processes. In addition, PRMT6 displays automethylation activity; it is the first PRMT to do so. PRMT6 has been shown to act as a restriction factor for HIV replication.

Long Name

Protein arginine N-methyltransferase 6

Alternate Names

HRMT1L6

Gene Symbol

PRMT6

Additional PRMT6 Products

Product Documents for PRMT6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PRMT6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PRMT6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PRMT6 Antibody - BSA Free and earn rewards!

Have you used PRMT6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies