Proteasome subunit beta type 4 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-54592
Loading...
Key Product Details
Species Reactivity
Human, Rat
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Synthetic peptides corresponding to PSMB4(proteasome (prosome, macropain) subunit, beta type, 4) The peptide sequence was selected from the middle region of PSMB4 (NP_002787).
Peptide sequence YLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMV. The peptide sequence for this immunogen was taken from within the described region.
Specificity
This product is specific to Subunit or Isoform: beta type-4.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for Proteasome subunit beta type 4 Antibody - BSA Free
Western Blot: Proteasome subunit beta type 4 Antibody [NBP1-54592]
Western Blot: Proteasome subunit beta type 4 Antibody [NBP1-54592] - WB analysis of Proteasome subunit beta type 4 in rat whole brain extract. Image courtesy of anonymous customer product review.Western Blot: Proteasome subunit beta type 4 Antibody [NBP1-54592]
Western Blot: Proteasome subunit beta type 4 Antibody [NBP1-54592] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.Applications for Proteasome subunit beta type 4 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Reviewed Applications
Read 1 review rated 4 using NBP1-54592 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Proteasome subunit beta type 4
Long Name
Proteasome subunit beta type-4
Alternate Names
HsBPROS26, HsN3, PROS-26, PROS26, Proteasome chain 3, PSMB4
Gene Symbol
PSMB4
UniProt
Additional Proteasome subunit beta type 4 Products
Product Documents for Proteasome subunit beta type 4 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Proteasome subunit beta type 4 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for Proteasome subunit beta type 4 Antibody - BSA Free (1)
4 out of 5
1 Customer Rating
Have you used Proteasome subunit beta type 4 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
1 of
1 review
Showing All
Filter By:
-
Application: Western BlotSample Tested: Rat whole brain extractSpecies: RatVerified Customer | Posted 09/06/2012
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...