ProTx I
1 Image
Description: CaV3.1 blocker; also inhibits NaV1.8 and KV2.1
Biological Activity
Selective CaV3.1 channel blocker (IC50 values are 0.2 and 31.8 μM for hCaV3.1 and hCaV3.2 respectively). Also reversibly inhibits NaV1.8 and blocks KV2.1 channels.Technical Data
M.Wt:
3987.51
Formula:
C171H245N53O47S6
Sequence:
ECRYWLGGCSAGQTCCKHLVCSRRHGWCVWDGTFS
(Modifications: Disulfide bridge: 2-16, 9-21, 15-28)
Solubility:
Soluble to 2 mg/ml in water
Storage:
Store at -20°C
CAS No:
484598-35-8
The technical data provided above is for guidance only.
For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Background References
-
Tarantula toxin ProTx-I differentiates between human T-type voltage-gated Ca2+ channels Cav3.1 and Cav3.2.
Ohkubo et al.
J.Pharmacol.Sci., 2010;112:452 -
T-type voltage-activated calcium channel Cav3.1, but not Cav3.2, is involved in the inhibition of proliferation and apoptosis in MCF-7 human breast cancer cells.
Ohkubo and Yamazaki
Int.J.Oncol., 2012;41:267 -
Two tarantula peptides inhibit activation of multiple sodium channels.
Middleton et al.
Biochemistry, 2002;41:14734
Product Datasheets
Or select another batch:
Reconstitution Calculator
Molarity Calculator
Reconstitution Calculator
Molarity Calculator
FAQs
No product specific FAQs exist for this product, however you may
View all Peptide FAQsReviews for ProTx I
There are currently no reviews for this product. Be the first to review ProTx I and earn rewards!
Have you used ProTx I?
Submit a review and receive an Amazon gift card.
$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Tocris Bioscience is the leading supplier of novel and exclusive
tools for
life science research with over 30 years' experience in the
industry.
Tocris is a Bio-Techne brand.
