PRPF6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57544

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PRPF6 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to PRPF6(PRP6 pre-mRNA processing factor 6 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of PRPF6. Peptide sequence PGKRTVGDQMKKNQAADDDDEDLNDTNYDEFNGYAGSLFSSGPYEKDDEE. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PRPF6 Antibody - BSA Free

Western Blot: PRPF6 Antibody [NBP1-57544]

Western Blot: PRPF6 Antibody [NBP1-57544]

Western Blot: PRPF6 Antibody [NBP1-57544] - Transfected 293T cell lysate, concentration 2.5 ug/ml.

Applications for PRPF6 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PRPF6

PRPF6 appears to be involved in pre-mRNA splicing, possibly acting as a bridging factor between U5 and U4/U6 snRNPs in formation of the spliceosome. PRPF6 also can bind androgen receptor, providing a link between transcriptional activation and splicing.The protein encoded by this gene appears to be involved in pre-mRNA splicing, possibly acting as a bridging factor between U5 and U4/U6 snRNPs in formation of the spliceosome. The encoded protein also can bind androgen receptor, providing a link between transcriptional activation and splicing.

Alternate Names

androgen receptor N-terminal domain transactivating protein-1, ANT-1, bB152O15.1, C20orf14, chromosome 20 open reading frame 14, hPrp6, p102 U5 small nuclear ribonucleoprotein particle-binding protein, pre-mRNA-processing factor 6, Prp6, PRP6 homolog, PRP6 pre-mRNA processing factor 6 homolog (S. cerevisiae), PRP6 pre-mRNA processing factor 6 homolog (yeast), putative mitochondrial outer membrane protein import receptor, TOM, U5 snRNP-associated 102 kDa protein, U5-102 kDa protein, U5-102K

Gene Symbol

PRPF6

Additional PRPF6 Products

Product Documents for PRPF6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PRPF6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PRPF6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PRPF6 Antibody - BSA Free and earn rewards!

Have you used PRPF6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies