PSG3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82317

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PSG3. Peptide sequence: HIVKRGDGTRGETGHFTFTLYLETPKPSISSSNLYPREDMEAVSLTCDPE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PSG3 Antibody - BSA Free

Western Blot: PSG3 Antibody [NBP2-82317]

Western Blot: PSG3 Antibody [NBP2-82317]

Western Blot: PSG3 Antibody [NBP2-82317] - Host: Rabbit. Target Name: PSG3. Sample Tissue: Human MCF7 Whole Cell. Antibody Dilution: 1.0ug/ml

Applications for PSG3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PSG3

The human pregnancy-specific glycoproteins (PSGs) are a family of proteins that are synthesized in large amounts by placental trophoblasts and released into the maternal circulation during pregnancy. Molecular cloning and analysis of several PSG genes has indicated that the PSGs form a subgroup of the carcinoembryonic antigen (CEA) gene family, which belongs to the immunoglobulin superfamily of genes. Members of the CEA family consist of a single N domain, with structural similarity to the immunoglobulin variable domains, followed by a variable number of immunoglobulin constant-like A and/or B domains. Most PSGs have an arg-gly-asp (RGD) motif, which has been shown to function as an adhesion recognition signal for several integrins, in the N-terminal domain (summary by Teglund et al., 1994 (PubMed 7851896)). For additional general information about the PSG gene family, see PSG1 (MIM 176390).(supplied by OMIM)

Long Name

Pregnancy Specific Beta-1-Glycoprotein 3

Alternate Names

Carcinoembryonic Antigen SG5, PSBG3

Gene Symbol

PSG3

Additional PSG3 Products

Product Documents for PSG3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PSG3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PSG3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PSG3 Antibody - BSA Free and earn rewards!

Have you used PSG3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...