PSMA2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54633

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PSMA2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to PSMA2(proteasome (prosome, macropain) subunit, alpha type, 2) The peptide sequence was selected from the N terminal of PSMA2 (NP_002778), Peptide sequence VGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMGPDYRV. The peptide sequence for this immunogen was taken from within the described region.

Specificity

This product is specific to Subunit or Isoform: alpha type-2.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PSMA2 Antibody - BSA Free

Western Blot: PSMA2 Antibody [NBP1-54633]

Western Blot: PSMA2 Antibody [NBP1-54633]

Western Blot: PSMA2 Antibody [NBP1-54633] - Analysis of 721_B cell lysate. Antibody Dilution: 1.0 ug/ml PSMA2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
Western Blot: PSMA2 Antibody [NBP1-54633]

Western Blot: PSMA2 Antibody [NBP1-54633]

Western Blot: PSMA2 Antibody [NBP1-54633] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: PSMA2 Antibody [NBP1-54633]

Western Blot: PSMA2 Antibody [NBP1-54633]

Western Blot: PSMA2 Antibody [NBP1-54633] - Analysis of 293T cell lysate. Antibody Dilution: 1.0 ug/ml There is BioGPS gene expression data showing that PSMA2 is expressed in HEK293T.
Western Blot: PSMA2 Antibody [NBP1-54633]

Western Blot: PSMA2 Antibody [NBP1-54633]

Western Blot: PSMA2 Antibody [NBP1-54633] - Hela, Antibody Dilution: 1.0 ug/ml PSMA2 is supported by BioGPS gene expression data to be expressed in HeLa.
Western Blot: PSMA2 Antibody [NBP1-54633]

Western Blot: PSMA2 Antibody [NBP1-54633]

Western Blot: PSMA2 Antibody [NBP1-54633] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Western Blot: PSMA2 Antibody [NBP1-54633]

Western Blot: PSMA2 Antibody [NBP1-54633]

Western Blot: PSMA2 Antibody [NBP1-54633] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.
Western Blot: PSMA2 Antibody [NBP1-54633]

Western Blot: PSMA2 Antibody [NBP1-54633]

Western Blot: PSMA2 Antibody [NBP1-54633] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: PSMA2 Antibody [NBP1-54633]

Western Blot: PSMA2 Antibody [NBP1-54633]

Western Blot: PSMA2 Antibody [NBP1-54633] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
Western Blot: PSMA2 Antibody [NBP1-54633]

Western Blot: PSMA2 Antibody [NBP1-54633]

Western Blot: PSMA2 Antibody [NBP1-54633] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
Western Blot: PSMA2 Antibody [NBP1-54633]

Western Blot: PSMA2 Antibody [NBP1-54633]

Western Blot: PSMA2 Antibody [NBP1-54633] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.
Western Blot: PSMA2 Antibody [NBP1-54633]

Western Blot: PSMA2 Antibody [NBP1-54633]

Western Blot: PSMA2 Antibody [NBP1-54633] - MCF7, Antibody Dilution: 1.0 ug/ml There is BioGPS gene expression data showing that PSMA2 is expressed in MCF7.
Western Blot: PSMA2 Antibody [NBP1-54633]

Western Blot: PSMA2 Antibody [NBP1-54633]

Western Blot: PSMA2 Antibody [NBP1-54633] - Jurkat, Antibody Dilution: 1.0 ug/ml There is BioGPS gene expression data showing that PSMA2 is expressed in Jurkat.

Applications for PSMA2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PSMA2

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMA2 is a member of the peptidase T1A family, that is a 20S core alpha subunit.The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Long Name

Proteasome (Prosome, Macropain) Subunit, alpha Type, 2

Alternate Names

HC3, MU, PMSA2, PSC3

Entrez Gene IDs

5683 (Human)

Gene Symbol

PSMA2

UniProt

P25787

Additional PSMA2 Products

Product Documents for PSMA2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PSMA2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Cancer Biomarkers

Customer Reviews for PSMA2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PSMA2 Antibody - BSA Free and earn rewards!

Have you used PSMA2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies