PSMD8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54588

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PSMD8 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to PSMD8(proteasome (prosome, macropain) 26S subunit, non-ATPase, 8) The peptide sequence was selected from the C terminal of PSMD8. Peptide sequence DYAKKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQLEMIV. The peptide sequence for this immunogen was taken from within the described region.

Specificity

This product is specific to Subunit or Isoform: 8.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PSMD8 Antibody - BSA Free

Western Blot: PSMD8 Antibody [NBP1-54588]

Western Blot: PSMD8 Antibody [NBP1-54588]

Western Blot: PSMD8 Antibody [NBP1-54588] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Applications for PSMD8 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PSMD8

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. PSMD8 is a non-ATPase subunit of the 19S regulator. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides.

Alternate Names

26S proteasome non-ATPase regulatory subunit 8, 26S proteasome regulatory subunit p31, HIP6,26S proteasome regulatory subunit S14, HYPF, MGC1660, Nin1p, p3126S proteasome regulatory subunit RPN12, proteasome (prosome, macropain) 26S subunit, non-ATPase, 8, Rpn12, S14

Gene Symbol

PSMD8

Additional PSMD8 Products

Product Documents for PSMD8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PSMD8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PSMD8 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PSMD8 Antibody - BSA Free and earn rewards!

Have you used PSMD8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies