PTTG1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-46709

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PTTG1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LPKATRKALGTVNRATEKSVKTKGPLKQKQPSFSAKKMTEKTVKA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PTTG1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: PTTG1 Antibody [NBP2-46709]

Immunocytochemistry/ Immunofluorescence: PTTG1 Antibody [NBP2-46709]

Immunocytochemistry/Immunofluorescence: PTTG1/2/3 Antibody [NBP2-46709] - Staining of human cell line PC-3 shows localization to nucleoli & cytosol.
Immunohistochemistry-Paraffin: PTTG1 Antibody [NBP2-46709]

Immunohistochemistry-Paraffin: PTTG1 Antibody [NBP2-46709]

Immunohistochemistry-Paraffin: PTTG1 Antibody [NBP2-46709] - PTTG1/2/3 Antibody [NBP2-46709] - Staining of human testis shows strong cytoplasmic positivity in a subset of seminiferus ducts.

Applications for PTTG1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PTTG1

The product of the oncogene PTTG, pituitary tumor transforming gene, is a human homolog of the anaphase-inhibitor vertebrate protein, securin. PTTG is a 22 kDa protein that contains a basic amino-terminal domain and an acidic carboxy-terminal domain, which acts as a transactivation domain when fused to a heterologous DNA binding domain. Human PTTG is overexpressed in Jurkat and is also detected in human thymus, testis, and placenta. PTTG is mainly expressed in the cytoplasm and is also partially localized to the nucleus. Vertebrate PTTG regulates the separin Esp1, which promotes chromatid separation, to overcome the cohesive forces that hold sister chromatids together. This regulatory function of PTTG suggests that defective regulation of cohesion may contribute to cancer by promoting chromosome instability. Although vertebrate PTTG shares cell-cycle functions with its yeast securin counterparts Pds1p and Cut2, none share sequence homology.

Alternate Names

EAP1MGC126883, Esp1-associated protein, ESP1-associated protein 1, hPTTG, pituitary tumor-transforming 1, Pituitary tumor-transforming gene 1 protein, PTTGMGC138276, securin, Tumor-transforming protein 1, TUTR1HPTTG

Entrez Gene IDs

9232 (Human)

Gene Symbol

PTTG1

UniProt

O95997 (Human)

Additional PTTG1 Products

Product Documents for PTTG1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PTTG1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PTTG1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PTTG1 Antibody - BSA Free and earn rewards!

Have you used PTTG1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies