PURL Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-70692

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PURL Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to PFAS(phosphoribosylformylglycinamidine synthase (FGAR amidotransferase)) The peptide sequence was selected from the N terminal of PFAS. Peptide sequence ESIMSTQESSNPNNVLKFCDNSSAIQGKEVRFLRPEDPTRPSRFQQQQGL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PURL Antibody - BSA Free

Western Blot: PURL Antibody [NBP1-70692]

Western Blot: PURL Antibody [NBP1-70692]

Western Blot: PURL Antibody [NBP1-70692] - 293T Whole Cell lysates, Antibody Dilution: 0.05 ug/ml.
Western Blot: PURL Antibody [NBP1-70692]

Western Blot: PURL Antibody [NBP1-70692]

Western Blot: PURL Antibody [NBP1-70692] - 1. Human Skin Fibroblasts (100ug) 2. HEK273 cells (20ug) 3. HeLa skin cells(20ug) at 1:2,000.
Western Blot: PURL Antibody [NBP1-70692]

Western Blot: PURL Antibody [NBP1-70692]

Western Blot: PURL Antibody [NBP1-70692] - Titration: 0.2-1 ug/ml, Positive Control: 293T cell lysate.

Applications for PURL Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PURL

Purines are necessary for many cellular processes, including DNA replication, transcription, and energy metabolism. Ten enzymatic steps are required to synthesize inosine monophosphate (IMP) in the de novo pathway of purine biosynthesis. PFAS catalyzes the fourth step of IMP biosynthesis. Purines are necessary for many cellular processes, including DNA replication, transcription, and energy metabolism. Ten enzymatic steps are required to synthesize inosine monophosphate (IMP) in the de novo pathway of purine biosynthesis. The enzyme encoded by this gene catalyzes the fourth step of IMP biosynthesis.

Alternate Names

FGAM synthase, FGAMS, FGAR amidotransferase, formylglycinamide ribotide synthetase, KIAA0361, phosphoribosylformylglycinamidine synthase, PURL

Gene Symbol

PFAS

Additional PURL Products

Product Documents for PURL Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PURL Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PURL Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PURL Antibody - BSA Free and earn rewards!

Have you used PURL Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies