RAB1B Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-98500

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen for this antibody is RAB1B - C-terminal region. Peptide sequence TSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for RAB1B Antibody - BSA Free

Western Blot: RAB1B Antibody [NBP1-98500]

Western Blot: RAB1B Antibody [NBP1-98500]

Western Blot: RAB1B Antibody [NBP1-98500] - Host: Mouse. Target Name: RAB1B. Sample Tissue: Mouse Brain. Antibody Dilution: 1ug/ml
Western Blot: RAB1B Antibody [NBP1-98500]

Western Blot: RAB1B Antibody [NBP1-98500]

Western Blot: RAB1B Antibody [NBP1-98500] - Human Fetal Kidney Lysate, concentration 1ug/ml.
Western Blot: RAB1B Antibody [NBP1-98500]

Western Blot: RAB1B Antibody [NBP1-98500]

Western Blot: RAB1B Antibody [NBP1-98500] - human Hela Cells and Monkey Vera.

Applications for RAB1B Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RAB1B

Members of the RAB protein family, such as RAB1B, are low molecular mass monomeric GTPases localized on the cytoplasmic surfaces of distinct membrane-bound organelles. RAB1B functions in the early secretory pathway and is essential for vesicle transport between the endoplasmic reticulum (ER) and Golgi.

Alternate Names

RAB1B, member RAS oncogene family, ras-related protein Rab-1B, small GTP-binding protein

Gene Symbol

RAB1B

Additional RAB1B Products

Product Documents for RAB1B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RAB1B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RAB1B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RAB1B Antibody - BSA Free and earn rewards!

Have you used RAB1B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...