RAB23 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-58855

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to RAB23(RAB23, member RAS oncogene family) The peptide sequence was selected from the N terminal of RAB23. Peptide sequence TKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQA. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for RAB23 Antibody - BSA Free

Western Blot: RAB23 Antibody [NBP1-58855]

Western Blot: RAB23 Antibody [NBP1-58855]

Western Blot: RAB23 Antibody [NBP1-58855] - Titration: 0.2-1 ug/ml, Positive Control: Human Muscle.

Applications for RAB23 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RAB23

The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. It may be involved in small GTPase mediated signal transduction and intracellular protein transportation. Alternative splicing occurs at this locus and two transcript va

Alternate Names

DKFZp781H0695, HSPC137, MGC8900, RAB family small GTP binding protein RAB 23, RAB23, member RAS oncogene family, ras-related protein Rab-23

Gene Symbol

RAB23

UniProt

Additional RAB23 Products

Product Documents for RAB23 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RAB23 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RAB23 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RAB23 Antibody - BSA Free and earn rewards!

Have you used RAB23 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for RAB23 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All
  • Q: I am planning to use one of the anti-Rab23 antibodies you offer (NBP1-58855) on tissue from non-mammalian samples. I wanted to ask if it is possible for me to get more data about the antibody (e.g. western blots, immunohistochemistry pictures)?

    A: In regards to your inquiry about the anti-RAB23 antibody, there are currently no IHC images that we are able to provide. This is because the antibody has not been tested yet for that application. The western blot data that we are able to provide is on the datasheet. This antibody has not yet been tested on non-mammalian species. If you have a species of interest and the protein sequence we can run an alignment for you to see the similarity. The exact sequence the antibody was raised against is listed on the datasheet, and if you run an alignment or blast, you can check how likely it is to cross react. We typically don't recommend testing anything unless it is 80% or higher.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies
Loading...