RAB37 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82324

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RAB37. Peptide sequence: ERVIRSEDGETLAREYGVPFLETSAKTGMNVELAFLAIAKELKYRAGHQA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for RAB37 Antibody - BSA Free

Western Blot: RAB37 Antibody [NBP2-82324]

Western Blot: RAB37 Antibody [NBP2-82324]

Western Blot: RAB37 Antibody [NBP2-82324] - WB Suggested Anti-RAB37 Antibody Titration: 0.2-1 ug/ml. Positive Control: Transfected 293T
Western Blot: RAB37 Antibody [NBP2-82324]

Western Blot: RAB37 Antibody [NBP2-82324]

Western Blot: RAB37 Antibody [NBP2-82324] - Sample Type: 1. Human Cervical Cancer Cell Lysate (15ug). 2. Monkey Fibroblast Cell Lysate (15ug). Primary Dilution: 1:1000. Secondary Antibody. : goat anti-Rabbit. Secondary Dilution: 1:40,000. Image Submitted by: Dr. Jakob Szwedo, Dr. Lupashin's Lab. Un

Applications for RAB37 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RAB37

Belonging to the small GTPase superfamily/ Rab family, RAB37 is involved with protein transport and small GTPase mediated signal transduction. Being a critical regulator of vesicular fusion and trafficking, Rab proteins are low molecular mass GTPases. Similarly, the molecular functions of these proteins include protein and GTP binding. RAB37 interacts with RAB5A, RIMS1, EWSR1, DTX4 and PCSK5. Diseases associated with RAB37 include renal cell carcinoma, lung cancer, hemophagocytic lymphohistiocytosis, Crohn's disease, psoriasis and neuronitis.

Alternate Names

FLJ32507, member of RAS oncogene family, RAB37, member RAS oncogene family, ras-related protein Rab-37

Gene Symbol

RAB37

Additional RAB37 Products

Product Documents for RAB37 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RAB37 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RAB37 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RAB37 Antibody - BSA Free and earn rewards!

Have you used RAB37 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...