RABGGTA Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55183

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RABGGTA Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to RABGGTA(Rab geranylgeranyltransferase, alpha subunit) The peptide sequence was selected from the N terminal of RABGGTA (NP_878256). Peptide sequence ELAFTDSLITRNFSNYSSWHYRSCLLPQLHPQPDSGPQGRLPEDVLLKEL. The peptide sequence for this immunogen was taken from within the described region.

Specificity

This product is specific to Subunit or Isoform: alpha.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

65 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for RABGGTA Antibody - BSA Free

Western Blot: RABGGTA Antibody [NBP1-55183]

Western Blot: RABGGTA Antibody [NBP1-55183]

Western Blot: RABGGTA Antibody [NBP1-55183] - Antibody Titration: 0.2-1 ug/ml Positive control: Jurkat cell lysate RABGGTA is supported by BioGPS gene expression data to be expressed in Jurkat.
Western Blot: RABGGTA Antibody [NBP1-55183]

Western Blot: RABGGTA Antibody [NBP1-55183]

Western Blot: RABGGTA Antibody [NBP1-55183] - Jurkat cell lysate, concentration 0.2-1 ug/ml.
Western Blot: RABGGTA Antibody [NBP1-55183]

Western Blot: RABGGTA Antibody [NBP1-55183]

Western Blot: RABGGTA Antibody [NBP1-55183] - Hela, Antibody Dilution: 1.0 ug/ml RABGGTA is supported by BioGPS gene expression data to be expressed in HeLa.

Applications for RABGGTA Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RABGGTA

RABGGTA belongs to the protein prenyltransferase subunit alpha family and contains 6 PFTA repeats. RABGGTA catalyzes the transfer of a geranyl-geranyl moiety from geranyl-geranyl pyrophosphate to both cysteines in Rab proteins with an -XXCC, -XCXC and -CCXX C-terminal, such as RAB1A, RAB3A and RAB5A respectively.

Alternate Names

EC 2.5.1.60, Geranylgeranyl transferase type II subunit alpha, geranylgeranyl transferase type-2 subunit alpha, protein prenyltransferase alpha subunit repeat containing 3, PTAR3, Rab geranylgeranyltransferase subunit alpha, Rab geranyl-geranyltransferase subunit alpha, Rab geranylgeranyltransferase, alpha subunit, Rab GG transferase alpha, Rab GGTase alpha

Entrez Gene IDs

5875 (Human)

Gene Symbol

RABGGTA

UniProt

Q92696 (Human)

Additional RABGGTA Products

Product Documents for RABGGTA Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RABGGTA Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for RABGGTA Antibody - BSA Free

Customer Reviews for RABGGTA Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RABGGTA Antibody - BSA Free and earn rewards!

Have you used RABGGTA Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies