Rad51D Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82330

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human RAD51D. Peptide sequence: DTIEGAGASGGRRMACLAKSSRQPTGFQEMVDIGTWGTSEQSATLQGDQT The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Rad51D Antibody - BSA Free

Western Blot: Rad51D Antibody [NBP2-82330]

Western Blot: Rad51D Antibody [NBP2-82330]

Western Blot: Rad51D Antibody [NBP2-82330] - WB Suggested Anti-RAD51L3 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Heart

Applications for Rad51D Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Rad51D

The Rad51 DNA repair protein is a key component of the double-strand break repair pathway and is essential for mitotic and meiotic recombination and genomic stability. Five human RAD51 homologues have been identified: XRCC2, XRCC3, RAD51B, RAD51C, and RAD51D. Each of these homologues interacts with one or more of the others, with all of the proteins involved with either one complex or with multiple smaller complexes. RAD51D interacts with XRCC2 and RAD51C (1). RAD51D's expression pattern and sequence similarity to other RAD51 family members most likely makes it part of a complex of proteins required for DNA repair and meiotic recombination.

Alternate Names

DNA repair protein RAD51 homolog 4, HsTRAD, R51H3Trad, RAD51 homolog D, RAD51DRAD51 (S. cerevisiae)-like 3, RAD51-like 3 (S. cerevisiae), RAD51-like protein 3, recombination repair protein, TRAD

Gene Symbol

RAD51D

Additional Rad51D Products

Product Documents for Rad51D Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Rad51D Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Rad51D Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Rad51D Antibody - BSA Free and earn rewards!

Have you used Rad51D Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...