Rasgrp1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-98413

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Rasgrp1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen for this antibody is RASGRP1 - C-terminal region. Peptide sequence LGAKDLLHAPEEGPFTFPNGEAVEHGEESKDRTIMLMGVSSQKISLRLKR. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

90 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Rasgrp1 Antibody - BSA Free

Western Blot: Rasgrp1 Antibody [NBP1-98413]

Western Blot: Rasgrp1 Antibody [NBP1-98413]

Western Blot: Rasgrp1 Antibody [NBP1-98413] - Host: Rabbit. Target Name: RASGRP1. Sample Tissue: Human HCT116 Whole Cell. Antibody Dilution: 3ug/ml
Western Blot: Rasgrp1 Antibody [NBP1-98413]

Western Blot: Rasgrp1 Antibody [NBP1-98413]

Western Blot: Rasgrp1 Antibody [NBP1-98413] - Jurkat Cell Lysate 1.0ug/ml, Gel Concentration: 6-18%

Applications for Rasgrp1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Rasgrp1

This gene is a member of a family of genes characterized by the presence of a Ras superfamily guanine nucleotide exchange factor (GEF) domain. It functions as a diacylglycerol (DAG)-regulated nucleotide exchange factor specifically activating Ras through the exchange of bound GDP for GTP. It activates the Erk/MAP kinase cascade and regulates T-cells and B-cells development, homeostasis and differentiation. Alternatively spliced transcript variants encoding different isoforms have been identified. Altered expression of the different isoforms of this protein may be a cause of susceptibility to systemic lupus erythematosus (SLE).

Alternate Names

CALDAG-GEFI, CALDAG-GEFII, hRasGRP1, RAS guanyl releasing protein 1 (calcium and DAG-regulated), RAS guanyl-releasing protein 1, RASGRP

Gene Symbol

RASGRP1

UniProt

NP_005730 (Human)

Additional Rasgrp1 Products

Product Documents for Rasgrp1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Rasgrp1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Rasgrp1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Rasgrp1 Antibody - BSA Free and earn rewards!

Have you used Rasgrp1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies