RAX2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88130

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all RAX2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RAX2. Peptide sequence: MFLSPGEGPATEGGGLGPGEEAPKKKHRRNRTTFTTYQLHQLERAFEASH The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RAX2 Antibody - BSA Free

Western Blot: RAX2 Antibody [NBP2-88130]

Western Blot: RAX2 Antibody [NBP2-88130]

Western Blot: RAX2 Antibody [NBP2-88130] - WB Suggested Anti-RAXL1 Antibody Titration: 1.25ug/ml. ELISA Titer: 1:312500. Positive Control: Jurkat cell lysate

Applications for RAX2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RAX2

RAX2 encodes a homeodomain-containing protein that plays a role in eye development. Mutation of this gene causes age-related macular degeneration type 6, an eye disorder resulting in accumulations of protein and lipid beneath the retinal pigment epithelium and within the Bruch's membrane. Defects in this gene can also cause cone-rod dystrophy type 11, a disease characterized by the initial degeneration of cone photoreceptor cells and resulting in loss of color vision and visual acuity, followed by the degeneration of rod photoreceptor cells, which progresses to night blindness and the loss of peripheral vision. [provided by RefSeq]

Alternate Names

CORD11, MGC15631, QRXQ50-type retinal homeobox protein, RAXL1ARMD6, retina and anterior neural fold homeobox 2, retina and anterior neural fold homeobox like 1, retina and anterior neural fold homeobox protein 2, Retina and anterior neural fold homeobox-like protein 1

Gene Symbol

RAX2

Additional RAX2 Products

Product Documents for RAX2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RAX2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RAX2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RAX2 Antibody - BSA Free and earn rewards!

Have you used RAX2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies