RbAp46 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86767

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all RbAp46 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RbAp46. Peptide sequence: HWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGH The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RbAp46 Antibody - BSA Free

Western Blot: RbAp46 Antibody [NBP2-86767]

Western Blot: RbAp46 Antibody [NBP2-86767]

Western Blot: RbAp46 Antibody [NBP2-86767] - WB Suggested Anti-RBBP7 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: HepG2 cell lysate

Applications for RbAp46 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RbAp46

RBBP7 antibody, also known as RbAp46 (Retinoblastoma protein associated protein 46), is a nuclear protein that has been shown to interact directly with retinoblastoma protein and is a component of the mSin3 corepressor complex, as are the histone deacetylase proteins (HDACs). It shares about 75% sequence identity with the closely related RbAp48, and appears to be functionally related to the yeast MSI1 protein in that overexpression of RbAp46 suppresses heat shock sensitivity in a RAS pathway dependent manner. RBBP7 has also been demonstrated to be up-regulated by the Wilms' tumor suppressor gene product, WT1. In addition, cells transfected with this antibody have shown strong inhibition of growth.

Alternate Names

G1/S transition control protein-binding protein RbAp46, Histone acetyltransferase type B subunit 2, histone-binding protein RBBP7, MGC138867, Nucleosome-remodeling factor subunit RBAP46, RBAP46, RBBP-7, retinoblastoma binding protein 7, Retinoblastoma-binding protein 7MGC138868, Retinoblastoma-binding protein p46, retinoblastoma-binding protein RbAp46

Gene Symbol

RBBP7

Additional RbAp46 Products

Product Documents for RbAp46 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RbAp46 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RbAp46 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RbAp46 Antibody - BSA Free and earn rewards!

Have you used RbAp46 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies