RBED1 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-93265

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all RBED1 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 290-381 of human ELMOD3 (NP_001128493.1). ATFLHLAHVWRTQRKTISDSGFVLKELEVLAKKSPRRLLKTLELYLARVSKGQASLLGAQKCYGPEAPPFKDLTFTGESDLQSHSSEGVWLI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RBED1 Antibody - Azide and BSA Free

Western Blot: RBED1 AntibodyAzide and BSA Free [NBP2-93265]

Western Blot: RBED1 AntibodyAzide and BSA Free [NBP2-93265]

Western Blot: RBED1 Antibody [NBP2-93265] - Analysis of extracts of various cell lines, using RBED1 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

Applications for RBED1 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: RBED1

Alternate Names

C330008I15Rik, ELMO domain-containing protein 3, ELMO/CED-12 domain containing 3, FLJ21977, FLJ35601, liver-specific organic anion transporter 3TM12, LST3, MGC111036, organic anion transporter LST-3b, RBED1, RBM29, RNA binding motif and ELMO domain 1, RNA binding motif and ELMO/CED-12 domain 1, RNA binding motif protein 29, RNA-binding motif and ELMO domain-containing protein 1, RNA-binding motif protein 29, RNA-binding protein 29

Gene Symbol

ELMOD3

Additional RBED1 Products

Product Documents for RBED1 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RBED1 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for RBED1 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review RBED1 Antibody - Azide and BSA Free and earn rewards!

Have you used RBED1 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies