RCAN2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79477

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards the middle region of human RCAN2The immunogen for this antibody is RCAN2. Peptide sequence LHETQFRGKKLKLYFAQVQTPETDGDKLHLAPPQPAKQFLISPPSSPPVG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for RCAN2 Antibody - BSA Free

Western Blot: RCAN2 Antibody [NBP1-79477]

Western Blot: RCAN2 Antibody [NBP1-79477]

Western Blot: RCAN2 Antibody [NBP1-79477] - THP-1 cell lysate, concentration 0.2-1 ug/ml.

Applications for RCAN2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RCAN2

Calcipressin-2, also known as RCAN2, plays a key role in many physiological procedures. Expressed in fibroblasts, heart, brain, liver, and skeletal muscle, RCAN2 prevents calcineurin-dependent transcriptional responses by binding to the catalytic domain of calcineurin A. Translocation of the transcription factor NFATC1 can also be attributed to the binding of calcineurin A. Further research indicates that RCAN could also play a role in endothelial cell function, angiogenesis and central nervous system development.

Alternate Names

Calcipressin 2 (Thyroid hormone-responsive protein ZAKI-4) (Down syndromecandidate region 1-like 1) (Myocyte-enriched calcineurin interacting protein2) (MCIP2), calcipressin-2, Down syndrome candidate region 1-like 1, Down syndrome critical region gene 1-like 1, DSCR1L1MCIP2ZAKI4RCN2, hRCN2, Myocyte-enriched calcineurin-interacting protein 2, regulator of calcineurin 2CSP2, thyroid hormone-responsive (skin fibroblasts), Thyroid hormone-responsive protein ZAKI-4, ZAKI-4

Gene Symbol

RCAN2

Additional RCAN2 Products

Product Documents for RCAN2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RCAN2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RCAN2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RCAN2 Antibody - BSA Free and earn rewards!

Have you used RCAN2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...