RDH10 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-62636

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RDH10 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to RDH10(retinol dehydrogenase 10 (all-trans)) The peptide sequence was selected from the N terminal of RDH10. Peptide sequence QSNEETAGMVRHIYRDLEAADAAALQAGNGEEEILPHCNLQVFTYTCDVG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for RDH10 Antibody - BSA Free

Western Blot: RDH10 Antibody [NBP1-62636]

Western Blot: RDH10 Antibody [NBP1-62636]

Western Blot: RDH10 Antibody [NBP1-62636] - Human Heart lysate, concentration 0.2-1 ug/ml.

Applications for RDH10 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RDH10

RDH10 is a retinol dehydrogenase with a clear preference for NADP. RDH10 converts all-trans-retinol to all-trans-retinal. RDH10 has no detectable activity towards 11-cis-retinol, 9-cis-retinol and 13-cis-retinol.RDH10 generates all-trans retinal from all-trans retinol and may plan an important role in the photic visual cycle. All-trans retinal is isomerized to 11-cis retinal by the retinal G protein-coupled receptor (RGR; MIM 600342) when the retinal pigment epithelium (RPE) is illuminated.[supplied by OMIM].

Alternate Names

EC 1.1.1, EC 1.1.1.300, EC 1.1.1.n2, retinol dehydrogenase 10, retinol dehydrogenase 10 (all-trans), SDR16C4, short chain dehydrogenase/reductase family 16C, member 4

Gene Symbol

RDH10

UniProt

Q8IZV5 (Human)

Additional RDH10 Products

Product Documents for RDH10 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RDH10 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RDH10 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RDH10 Antibody - BSA Free and earn rewards!

Have you used RDH10 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies