RDM1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-53147

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to RDM1(RAD52 motif 1) The peptide sequence was selected from the middle region of RDM1. Peptide sequence NSSKCQELANYYFGFNGCSKRIIKLQELSDLEERENEDSMVPLPKQSLKF. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for RDM1 Antibody - BSA Free

Western Blot: RDM1 Antibody [NBP1-53147]

Western Blot: RDM1 Antibody [NBP1-53147]

Western Blot: RDM1 Antibody [NBP1-53147] - Human Placenta lysate, concentration 0.2-1 ug/ml.

Applications for RDM1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RDM1

RDM1 is a protein involved in the cellular response to cisplatin, a drug commonly used in chemotherapy. It contains two motifs: a motif found in RAD52, a protein that functions in DNA double-strand breaks and homologous recombination, and an RNA recognition motif (RRM) that is not found in RAD52. The RAD52 motif region in RAD52 is important for protein function and may be involved in DNA binding or oligomerization.This gene encodes a protein involved in the cellular response to cisplatin, a drug commonly used in chemotherapy. The protein encoded by this gene contains two motifs: a motif found in RAD52, a protein that functions in DNA double-strand breaks and homologous recombination, and an RNA recognition motif (RRM) that is not found in RAD52. The RAD52 motif region in RAD52 is important for protein function and may be involved in DNA binding or oligomerization. Alternatively spliced transcript variants encoding different isoforms have been reported.

Alternate Names

MGC33977, RAD52 homolog B, RAD52 homolog B (S. cerevisiae), RAD52 motif 1, RAD52 motif-containing protein 1, RAD52B

Gene Symbol

RDM1

UniProt

Additional RDM1 Products

Product Documents for RDM1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RDM1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RDM1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RDM1 Antibody - BSA Free and earn rewards!

Have you used RDM1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...