Reg1A Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-98445

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen for this antibody is Reg1 - middle region. Peptide sequence LHDPKRNRRWHWSSGSLFLYKSWATGSPNSSNRGYCVSLTSNTGYKKWKD. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

165 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Reg1A Antibody - BSA Free

Western Blot: Reg1A Antibody [NBP1-98445]

Western Blot: Reg1A Antibody [NBP1-98445]

Western Blot: Reg1A Antibody [NBP1-98445] - Sample Tissue: Human Fetal Kidney Antibody Dilution: 1.0 ug/ml
Western Blot: Reg1A Antibody [NBP1-98445]

Western Blot: Reg1A Antibody [NBP1-98445]

Western Blot: Reg1A Antibody [NBP1-98445] - Mouse Pancreas lysate, concentration 1 ug/ml.

Applications for Reg1A Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Reg1A

The Reg family constitutes a subset of the calcium-dependent C-type lectin superfamily. These small, secreted proteins have been implicated in a range of physiological processes including acting as acute phase reactants, lectins, survival/growth factors for insulin-producing pancreatic beta-cells, neural cells, and epithelial cells of the digestive system. Studies also indicate a role for Reg family members in tumor formation and indicate their potential for use as biomarkers of carcinogenesis.

Reg1A, also known as PTP, PSP, and lithostathine, is a member of the Reg family of secreted proteins with a C-type lectin domain. Due to variable glycosylation, pancreatic Reg1A exists as multiple species of 16 - 18 kDa. Reg1A promotes the maintenance and growth of pancreatic islet β-cells and intestinal villi. It is upregulated in pancreatitis and some carcinomas. Reg1A is an antigenic target in autoimmune diabetes. Human Reg1A shares 65% - 68% aa sequence identity with mouse and rat Reg1A.

Long Name

Regenerating Islet-derived 1A

Alternate Names

ICRF, PSP, PTP

Gene Symbol

REG1A

Additional Reg1A Products

Product Documents for Reg1A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Reg1A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Reg1A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Reg1A Antibody - BSA Free and earn rewards!

Have you used Reg1A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...