RGL3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-92327

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RGL3 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: VEIKKTAVQDLSFNKNLRAVVSVLGSWLQDHPQDFRDHPAHSDLGSVRTFLGWAAPGSAEAQKAEKLLED

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RGL3 Antibody - BSA Free

Western Blot: RGL3 Antibody [NBP1-92327]

Western Blot: RGL3 Antibody [NBP1-92327]

Western Blot: RGL3 Antibody [NBP1-92327] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: RGL3 Antibody [NBP1-92327]

Immunohistochemistry-Paraffin: RGL3 Antibody [NBP1-92327]

Immunohistochemistry-Paraffin: RGL3 Antibody [NBP1-92327] - Staining of human testis shows strong cytoplasmic positivity in cells of seminiferus ducts.
RGL3 Antibody - BSA Free Western Blot: RGL3 Antibody - BSA Free [NBP1-92327]

Western Blot: RGL3 Antibody - BSA Free [NBP1-92327]

Analysis in control (vector only transfected HEK293T lysate) and RGL3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).
RGL3 Antibody - BSA Free Western Blot: RGL3 Antibody - BSA Free [NBP1-92327]

Western Blot: RGL3 Antibody - BSA Free [NBP1-92327]

Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Human cell line RT-4

Applications for RGL3 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RGL3

Guanine nucleotide exchange factor (GEF) for Ral-A. Potential effector of GTPase HRas and Ras-related proteinM-Ras. Negatively regulates Elk-1-dependent gene induction downstream of HRas and MEKK1

Alternate Names

FLJ00153, FLJ32585, FLJ44275, MGC126805, MGC138163, ral guanine nucleotide dissociation stimulator-like 3, RalGDS-like 3, RalGEF-like protein 3, mouse homolog

Gene Symbol

RGL3

Additional RGL3 Products

Product Documents for RGL3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RGL3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RGL3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RGL3 Antibody - BSA Free and earn rewards!

Have you used RGL3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies