RHD Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84247

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all RHD Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of RHD. Peptide sequence: DYHMNMMHIYVFAAYFGLSVAWCLPKPLPEGTEDKDQTATIPSLSAMLGA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RHD Antibody - BSA Free

Western Blot: RHD Antibody [NBP2-84247]

Western Blot: RHD Antibody [NBP2-84247]

Western Blot: RHD Antibody [NBP2-84247] - Host: Rabbit. Target Name: RHD. Sample Type: Human Fetal Liver. Antibody Dilution: 1.0ug/ml
Western Blot: RHD Antibody [NBP2-84247]

Western Blot: RHD Antibody [NBP2-84247]

Western Blot: RHD Antibody [NBP2-84247] - WB Suggested Anti-RHD Antibody. Titration: 1.0 ug/ml. Positive Control: RPMI-8226 Whole Cell.RHD is strongly supported by BioGPS gene expression data to be expressed in RPMI 8226
Western Blot: RHD Antibody [NBP2-84247]

Western Blot: RHD Antibody [NBP2-84247]

Western Blot: RHD Antibody [NBP2-84247] - Host: Rabbit. Target Name: RHD. Sample Type: 293T. Antibody Dilution: 1.0ug/mlRHD is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells
Western Blot: RHD Antibody [NBP2-84247]

Western Blot: RHD Antibody [NBP2-84247]

Western Blot: RHD Antibody [NBP2-84247] - Host: Rabbit. Target Name: RHD. Sample Type: Human Fetal Brain. Antibody Dilution: 1.0ug/ml
Western Blot: RHD Antibody [NBP2-84247]

Western Blot: RHD Antibody [NBP2-84247]

Western Blot: RHD Antibody [NBP2-84247] - Host: Rabbit. Target Name: RHD. Sample Type: Human Adult Placenta. Antibody Dilution: 1.0ug/ml

Applications for RHD Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RHD

The Rh blood group system is the second most clinically significant of the blood groups, second only to ABO. It is also the most polymorphic of the blood groups, with variations due to deletions, gene conversions, and missense mutations. The classification of Rh positive and Rh negative individuals is determined by the presence or absence of the highly immunogenic RhD protein on the surface of erythrocytes. Alternative splicing of the gene results in four transcript variants encoding four different isoforms.

Alternate Names

blood group Rh(D) polypeptide, CD240D, DIIIc, RH, Rh blood group, D antigen, RH30, Rh4, RHCED, RhDCw, RHDel, RHDVA(TT), RhII, RhK562-II, RhPI, RHPII, RHXIII

Gene Symbol

RHD

Additional RHD Products

Product Documents for RHD Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RHD Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RHD Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RHD Antibody - BSA Free and earn rewards!

Have you used RHD Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies