Rhodopsin Antibody (5N3G9)

Name: Rhodopsin Antibody (5N3G9)
Brand: Novus Biologicals
SKU: NBP3-16655
Price: 399 USD
Availability: InStock

Novus Biologicals | Catalog # NBP3-16655

Submit a review

Product Documents

Recombinant Monoclonal Antibody

100% Guarantee

Product Specifications
Scientific Data
Applications
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 5N3G9 expressed in HEK293

View all Rhodopsin Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 249-348 of human Rhodopsin (NP_000530.1). EVTRMVIIMVIAFLICWVPYASVAFYIFTHQGSNFGPIFMTIPAFFAKSAAIYNPVIYIMMNKQFRNCMLTTICCGKNPLGDDEASATVSKTETSQVAPA

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Rhodopsin Antibody (5N3G9)

Western Blot: Rhodopsin Antibody (5N3G9) [NBP3-16655]

Western Blot: Rhodopsin Antibody (5N3G9) [NBP3-16655] - Western blot analysis of extracts of various cell lines, using Rhodopsin Rabbit mAb (NBP3-16655) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

Immunohistochemistry-Paraffin: Rhodopsin Antibody (5N3G9) [NBP3-16655]

Immunohistochemistry-Paraffin: Rhodopsin Antibody (5N3G9) [NBP3-16655] - Immunohistochemistry of paraffin-embedded mouse retina using Rhodopsin Rabbit mAb (NBP3-16655) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Applications for Rhodopsin Antibody (5N3G9)

Application

Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Rhodopsin

Rhodopsin is a glycoprotein which is a visual pigment in mammals, birds, amphibians, and reptiles. The rhodopsin protein is present on the photoreceptor cells in the retina.

Long Name

Rhodopsin

Alternate Names

OPN2, Opsin-2, RHO

Gene Symbol

RHO

Additional Rhodopsin Products

Product Documents for Rhodopsin Antibody (5N3G9)

Download Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Rhodopsin Antibody (5N3G9)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Rhodopsin Antibody (5N3G9)

There are currently no reviews for this product. Be the first to review Rhodopsin Antibody (5N3G9) and earn rewards!

Have you used Rhodopsin Antibody (5N3G9)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image