RNF135 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56223

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RNF135 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GTSQLSAWHMVKETVLGSDRPGVVGIWLNLEEGKLAFYSVDNQEKLLYECTISASSPLYPAFWLYGLHPGNYLIIKQVKV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RNF135 Antibody - BSA Free

Western Blot: RNF135 Antibody [NBP2-56223]

Western Blot: RNF135 Antibody [NBP2-56223]

Western Blot: RNF135 Antibody [NBP2-56223] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Immunocytochemistry/ Immunofluorescence: RNF135 Antibody [NBP2-56223]

Immunocytochemistry/ Immunofluorescence: RNF135 Antibody [NBP2-56223]

Immunocytochemistry/Immunofluorescence: RNF135 Antibody [NBP2-56223] - Staining of human cell line A-431 shows localization to vesicles.

Applications for RNF135 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RNF135

RNF135 is encoded by this gene contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. This gene is located in a chromosomal region known to be frequently deleted in patients with neurofibromatosis. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq]

Alternate Names

E3 ubiquitin-protein ligase RNF135, EC 6.3.2.-, MGC13061, REUL, ring finger protein 135RIG-I E3 ubiquitin ligase, Riplet

Gene Symbol

RNF135

Additional RNF135 Products

Product Documents for RNF135 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RNF135 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RNF135 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RNF135 Antibody - BSA Free and earn rewards!

Have you used RNF135 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies