RNF187 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83456

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human RNF187. Peptide sequence: ESAAAVWKGHVMDRRKKALTDYKKLRAFFVEEEEHFLQEAEKEEGLPEDE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RNF187 Antibody - BSA Free

Western Blot: RNF187 Antibody [NBP2-83456]

Western Blot: RNF187 Antibody [NBP2-83456]

Western Blot: RNF187 Antibody [NBP2-83456] - Host: Rabbit. Target Name: RNF187. Sample Tissue: Human HepG2 Whole Cell. Antibody Dilution: 1ug/ml
RNF187 Antibody - BSA Free

Western Blot: RNF187 Antibody - BSA Free [NBP2-83456] -

Depletion of RNF187 impaired propranolol resistance of HemSCs. A, B mRNA and protein levels of RNF187 in HemSCs transfected with specific siRNAs against RNF187 (si-RNF187#1 and si-RNF187#2) or siRNA negative control (si-NC) were detected qRT-PCR and Western blot, respectively. C CCK-8 assay showed cell viability of HemSCs exposed to different concentration of propranolol for 72 h after transfection with si-RNF187#1, si-RNF187#2 or si-NC. D IC50 value of propranolol (72 h treatment) was calculated after HemSCs were transfected with si-RNF187#1, si-RNF187#2 or si-NC. E, F Expression of proliferative-related markers (Cyclin D1 and PCNA) in RNF187-silent HemSCs exposed to propranolol (20 μM) for 48 h was measured by qRT-PCR and Western blot, respectively. G, H Cell apoptosis of RNF187-silent HemSCs exposed to propranolol (20 μM) for 48 h were determined by caspase-3 activity assay (G) and Annexin-V/PI double staining assay (H). *P < 0.05; **P < 0.01; ***P < 0.001. (Two-way ANOVA for C, Student’s t-test for others) Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36167680), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
RNF187 Antibody - BSA Free

Western Blot: RNF187 Antibody - BSA Free [NBP2-83456] -

Circ_0000915 up-regulated RNF187 via inhibition of miR-890 in HemSCs. A The prediction for miR-890 binding sites on RNF187 transcripts and schematic of luciferase reporter vector constructs RNF187 3’UTR wild-type (RNF187 3’UTR-wt) and the miR-890-binding-site mutated (RNF187 3’UTR-mt) one. B Biotin-coupled miR-890 (Biotin-miR-890) captured a fold change of RNF187 mRNA in the complex as compared with biotin-coupled miR-NC (Biotin-miR-NC) in biotin-coupled miRNA capture in HemSCs. C, D The luciferase activities in HemSCs and HEK 293t cells co-transfected with miR-890 or miR-NC mimics and luciferase reporters containing RNF187 3’UTR-wt or RNF187 3’UTR-mt. E–G Expression of RNF187 in HemSCs transfected with miR-890 mimics and miR-890 inhibitor or their corresponding negative control was measured by qRT-PCR and Western blot. H–J Expression of RNF187 in Circ_0000915-silent and Circ_0000915-overexpressing HemSCs was measured by qRT-PCR and Western blot. Data are presented as mean +/- S.D from three independent experiments. *P < 0.05; **P < 0.011; ns = not significant. Student’s t-test Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36167680), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
RNF187 Antibody - BSA Free

Western Blot: RNF187 Antibody - BSA Free [NBP2-83456] -

Circ_0000915 up-regulated RNF187 via inhibition of miR-890 in HemSCs. A The prediction for miR-890 binding sites on RNF187 transcripts and schematic of luciferase reporter vector constructs RNF187 3’UTR wild-type (RNF187 3’UTR-wt) and the miR-890-binding-site mutated (RNF187 3’UTR-mt) one. B Biotin-coupled miR-890 (Biotin-miR-890) captured a fold change of RNF187 mRNA in the complex as compared with biotin-coupled miR-NC (Biotin-miR-NC) in biotin-coupled miRNA capture in HemSCs. C, D The luciferase activities in HemSCs and HEK 293t cells co-transfected with miR-890 or miR-NC mimics and luciferase reporters containing RNF187 3’UTR-wt or RNF187 3’UTR-mt. E–G Expression of RNF187 in HemSCs transfected with miR-890 mimics and miR-890 inhibitor or their corresponding negative control was measured by qRT-PCR and Western blot. H–J Expression of RNF187 in Circ_0000915-silent and Circ_0000915-overexpressing HemSCs was measured by qRT-PCR and Western blot. Data are presented as mean +/- S.D from three independent experiments. *P < 0.05; **P < 0.011; ns = not significant. Student’s t-test Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36167680), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for RNF187 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RNF187

Alternate Names

E3 ubiquitin-protein ligase RNF187, RACO-1, RING domain AP1 coactivator 1, ring finger protein 187

Gene Symbol

RNF187

Additional RNF187 Products

Product Documents for RNF187 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RNF187 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for RNF187 Antibody - BSA Free

Customer Reviews for RNF187 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RNF187 Antibody - BSA Free and earn rewards!

Have you used RNF187 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...