RNF187 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-83456
Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit
Format
BSA Free
Loading...
Product Specifications
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human RNF187. Peptide sequence: ESAAAVWKGHVMDRRKKALTDYKKLRAFFVEEEEHFLQEAEKEEGLPEDE The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Scientific Data Images for RNF187 Antibody - BSA Free
Western Blot: RNF187 Antibody [NBP2-83456]
Western Blot: RNF187 Antibody [NBP2-83456] - Host: Rabbit. Target Name: RNF187. Sample Tissue: Human HepG2 Whole Cell. Antibody Dilution: 1ug/mlWestern Blot: RNF187 Antibody - BSA Free [NBP2-83456] -
Depletion of RNF187 impaired propranolol resistance of HemSCs. A, B mRNA and protein levels of RNF187 in HemSCs transfected with specific siRNAs against RNF187 (si-RNF187#1 and si-RNF187#2) or siRNA negative control (si-NC) were detected qRT-PCR and Western blot, respectively. C CCK-8 assay showed cell viability of HemSCs exposed to different concentration of propranolol for 72 h after transfection with si-RNF187#1, si-RNF187#2 or si-NC. D IC50 value of propranolol (72 h treatment) was calculated after HemSCs were transfected with si-RNF187#1, si-RNF187#2 or si-NC. E, F Expression of proliferative-related markers (Cyclin D1 and PCNA) in RNF187-silent HemSCs exposed to propranolol (20 μM) for 48 h was measured by qRT-PCR and Western blot, respectively. G, H Cell apoptosis of RNF187-silent HemSCs exposed to propranolol (20 μM) for 48 h were determined by caspase-3 activity assay (G) and Annexin-V/PI double staining assay (H). *P < 0.05; **P < 0.01; ***P < 0.001. (Two-way ANOVA for C, Student’s t-test for others) Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36167680), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: RNF187 Antibody - BSA Free [NBP2-83456] -
Circ_0000915 up-regulated RNF187 via inhibition of miR-890 in HemSCs. A The prediction for miR-890 binding sites on RNF187 transcripts and schematic of luciferase reporter vector constructs RNF187 3’UTR wild-type (RNF187 3’UTR-wt) and the miR-890-binding-site mutated (RNF187 3’UTR-mt) one. B Biotin-coupled miR-890 (Biotin-miR-890) captured a fold change of RNF187 mRNA in the complex as compared with biotin-coupled miR-NC (Biotin-miR-NC) in biotin-coupled miRNA capture in HemSCs. C, D The luciferase activities in HemSCs and HEK 293t cells co-transfected with miR-890 or miR-NC mimics and luciferase reporters containing RNF187 3’UTR-wt or RNF187 3’UTR-mt. E–G Expression of RNF187 in HemSCs transfected with miR-890 mimics and miR-890 inhibitor or their corresponding negative control was measured by qRT-PCR and Western blot. H–J Expression of RNF187 in Circ_0000915-silent and Circ_0000915-overexpressing HemSCs was measured by qRT-PCR and Western blot. Data are presented as mean +/- S.D from three independent experiments. *P < 0.05; **P < 0.011; ns = not significant. Student’s t-test Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36167680), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: RNF187 Antibody - BSA Free [NBP2-83456] -
Circ_0000915 up-regulated RNF187 via inhibition of miR-890 in HemSCs. A The prediction for miR-890 binding sites on RNF187 transcripts and schematic of luciferase reporter vector constructs RNF187 3’UTR wild-type (RNF187 3’UTR-wt) and the miR-890-binding-site mutated (RNF187 3’UTR-mt) one. B Biotin-coupled miR-890 (Biotin-miR-890) captured a fold change of RNF187 mRNA in the complex as compared with biotin-coupled miR-NC (Biotin-miR-NC) in biotin-coupled miRNA capture in HemSCs. C, D The luciferase activities in HemSCs and HEK 293t cells co-transfected with miR-890 or miR-NC mimics and luciferase reporters containing RNF187 3’UTR-wt or RNF187 3’UTR-mt. E–G Expression of RNF187 in HemSCs transfected with miR-890 mimics and miR-890 inhibitor or their corresponding negative control was measured by qRT-PCR and Western blot. H–J Expression of RNF187 in Circ_0000915-silent and Circ_0000915-overexpressing HemSCs was measured by qRT-PCR and Western blot. Data are presented as mean +/- S.D from three independent experiments. *P < 0.05; **P < 0.011; ns = not significant. Student’s t-test Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36167680), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for RNF187 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: RNF187
Alternate Names
E3 ubiquitin-protein ligase RNF187, RACO-1, RING domain AP1 coactivator 1, ring finger protein 187
Gene Symbol
RNF187
Additional RNF187 Products
Product Documents for RNF187 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for RNF187 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for RNF187 Antibody - BSA Free
Customer Reviews for RNF187 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review RNF187 Antibody - BSA Free and earn rewards!
Have you used RNF187 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...