ROR beta Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88172

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ROR beta. Peptide sequence: KNHLDDETLAKLIAKIPTITAVCNLHGEKLQVFKQSHPEIVNTLFPPLYK The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Description

Novus Biologicals Rabbit ROR beta Antibody - BSA Free (NBP2-88172) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for ROR beta Antibody - BSA Free

Western Blot: ROR beta Antibody [NBP2-88172]

Western Blot: ROR beta Antibody [NBP2-88172]

Western Blot: ROR beta Antibody [NBP2-88172] - Host: Rabbit. Target Name: RORB. Sample Type: Human Fetal Lung. Antibody Dilution: 1.0ug/ml
Western Blot: ROR beta Antibody [NBP2-88172]

Western Blot: ROR beta Antibody [NBP2-88172]

Western Blot: ROR beta Antibody [NBP2-88172] - WB Suggested Anti-RORB Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Transfected 293T
Western Blot: ROR beta Antibody [NBP2-88172]

Western Blot: ROR beta Antibody [NBP2-88172]

Western Blot: ROR beta Antibody [NBP2-88172] - Host: Rabbit. Target Name: RORB. Sample Type: Human Fetal Liver. Antibody Dilution: 1.0ug/ml

Applications for ROR beta Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ROR beta/NR1F2

Retinoid-related orphan receptor beta (ROR beta), a NR1 thyroid hormone receptor, affects the development and functioning of the central nervous system, including sensory input integration and circadian timing. Disruption of ROR beta in mice results in juvenile ataxia, retinal degeneration, circadian activity abnormalities, and delayed onset of male fertility. ROR beta binds to the monomeric response elements containing the sequence AnnTAGGTCA as a monomer. An alternatively spliced isoform, ROR beta2, has been isolated from rats, and the expression of ROR beta2 is confined to the pineal gland and retina. ROR beta2 shares common DNA- and putative ligand-binding domains with wild-type ROR beta but is characterized by a different amino-terminal domain. ROR beta expression has been documented in various regions of the mouse brain. ESTs have been isolated from human tissue libraries, including cancerous human kidney and normal brain, pineal and eye.

Long Name

Retinoic Acid-Related Orphan Receptor beta

Alternate Names

NR1F2, RORB, RZRB

Gene Symbol

RORB

Additional ROR beta/NR1F2 Products

Product Documents for ROR beta Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ROR beta Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ROR beta Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ROR beta Antibody - BSA Free and earn rewards!

Have you used ROR beta Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...