RPL10 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-84037

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Mouse

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KMSSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRTKLQNKEHVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEFEDMVAEKRLIPDGCGVKYIPSRGPLDKWW

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RPL10 Antibody - BSA Free

Immunohistochemistry-Paraffin: RPL10 Antibody [NBP1-84037]

Immunohistochemistry-Paraffin: RPL10 Antibody [NBP1-84037]

Immunohistochemistry-Paraffin: RPL10 Antibody [NBP1-84037] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: RPL10 Antibody [NBP1-84037]

Immunohistochemistry-Paraffin: RPL10 Antibody [NBP1-84037]

Immunohistochemistry-Paraffin: RPL10 Antibody [NBP1-84037] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: RPL10 Antibody [NBP1-84037]

Immunohistochemistry-Paraffin: RPL10 Antibody [NBP1-84037]

Immunohistochemistry-Paraffin: RPL10 Antibody [NBP1-84037] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: RPL10 Antibody [NBP1-84037]

Immunohistochemistry-Paraffin: RPL10 Antibody [NBP1-84037]

Immunohistochemistry-Paraffin: RPL10 Antibody [NBP1-84037] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
RPL10 Antibody - BSA Free Western Blot: RPL10 Antibody - BSA Free [NBP1-84037]

Western Blot: RPL10 Antibody - BSA Free [NBP1-84037]

Analysis in human cell line HeLa.
RPL10 Antibody - BSA Free Western Blot: RPL10 Antibody - BSA Free [NBP1-84037]

Western Blot: RPL10 Antibody - BSA Free [NBP1-84037]

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
RPL10 Antibody - BSA Free

Western Blot: RPL10 Antibody - BSA Free [NBP1-84037] -

The effect of Rpl24Bst mutation on translation and ribosome composition.(A) Representative polysome profiles from Apcfl/fl KrasG12D/+ or Apcfl/fl KrasG12D/+ Rpl24Bst/+ small intestinal organoid cultures, pre-treated with harringtonine for 5 min/300 s (H300) or untreated (H0). These traces were analysed for the run-off rates shown in Figure 3E. (B) Representative polysome profiles from Apcfl/+ KrasG12D/+ or Apcfl/+ KrasG12D/+ Rpl24Bst/+ colonic adenoma cultures (left) and quantification of the polysome to subpolysome ratio from these (right). Two biologically independent lines were analysed per genotype and plotted +/- standard error of the mean (SEM). Scheme above denotes the generation of adenoma cultures from distinct colonic tumours in aged VillinCreER Apcfl/+ KrasG12D/+ and VillinCreER Apcfl/+ KrasG12D/+ Rpl24Bst/+ mice. (C) Relative protein synthesis rates quantified by 35S-methionine incorporation in the colonic adenoma cultures described in (B) with n = 3. The average protein synthesis rates were plotted relative to Apcfl/+ KrasG12D/+ controls (=1) for three organoid lines per genotype +/- SEM. Significance was determined by Mann–Whitney U test. (D) 60S to 40S ratio from sucrose density gradients from lysates generated from the indicated genotypes. Data show the mean +/- SEM. Representative traces are shown in Figure 3B and Figure 4—figure supplement 2B. (E) Western blotting from protein lysates generated from three biologically independent organoid lines for each genotype. Mean values for RPL24, RPL10, RPL22, and RPS6 expression relative to beta -actin and P-eEF2 T56 relative to eEF2 are shown next to the relevant blot +/- SEM. The average of the VillinCreER Apcfl/+ KrasG12D/+ lanes in all cases has been set to 1. Image collected and cropped by CiteAb from the following open publication (https://elifesciences.org/articles/69729), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for RPL10 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RPL10

The c-Jun protein is a major component of the transcription factor AP-1, originally shown to mediate phorbol ester tumor promoter (TPA)-induced expression of responsive genes through the TPA-response element (TRE). The Jun proteins form homo- and heterodimers which bind the TRE, while Fos proteins are active only as heterodimers with any of the Jun proteins. Fos/Jun heterodimers have a much higher affinity for the TRE than Jun homodimers. A distant member of the MAP kinase family, designated c-Jun NH2-terminal kinase (JNK1) functions to regulate c-Jun by phosphorylation at the amino terminal serine regulatory sites, Ser 63 and Ser 73). QM has been described as a transcription factor that can function to bind DNA directly or alternatively can interact with c-Jun to inhibit transactivation of AP-1 promoter driven reporter vectors by Jun-Jun homodimers. QM is highly conserved throughout eukaryotic evolution and is apparently a member of a multi-gene family.

Alternate Names

60S ribosomal protein L10, DXS648EFLJ27072, DXS648FLJ23544, Laminin receptor homolog, NOV, Protein QM, QMDKFZp686J1851, ribosomal protein L10, Tumor suppressor QM, Wilms tumor-related protein

Gene Symbol

RPL10

Additional RPL10 Products

Product Documents for RPL10 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RPL10 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for RPL10 Antibody - BSA Free

Customer Reviews for RPL10 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RPL10 Antibody - BSA Free and earn rewards!

Have you used RPL10 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...