RPL10 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-84037
Loading...
Key Product Details
Species Reactivity
Validated:
Human, Mouse, Rat
Cited:
Mouse
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KMSSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRTKLQNKEHVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEFEDMVAEKRLIPDGCGVKYIPSRGPLDKWW
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for RPL10 Antibody - BSA Free
Immunohistochemistry-Paraffin: RPL10 Antibody [NBP1-84037]
Immunohistochemistry-Paraffin: RPL10 Antibody [NBP1-84037] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.Immunohistochemistry-Paraffin: RPL10 Antibody [NBP1-84037]
Immunohistochemistry-Paraffin: RPL10 Antibody [NBP1-84037] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.Immunohistochemistry-Paraffin: RPL10 Antibody [NBP1-84037]
Immunohistochemistry-Paraffin: RPL10 Antibody [NBP1-84037] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.Immunohistochemistry-Paraffin: RPL10 Antibody [NBP1-84037]
Immunohistochemistry-Paraffin: RPL10 Antibody [NBP1-84037] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.Western Blot: RPL10 Antibody - BSA Free [NBP1-84037]
Analysis in human cell line HeLa.Western Blot: RPL10 Antibody - BSA Free [NBP1-84037]
Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.Western Blot: RPL10 Antibody - BSA Free [NBP1-84037] -
The effect of Rpl24Bst mutation on translation and ribosome composition.(A) Representative polysome profiles from Apcfl/fl KrasG12D/+ or Apcfl/fl KrasG12D/+ Rpl24Bst/+ small intestinal organoid cultures, pre-treated with harringtonine for 5 min/300 s (H300) or untreated (H0). These traces were analysed for the run-off rates shown in Figure 3E. (B) Representative polysome profiles from Apcfl/+ KrasG12D/+ or Apcfl/+ KrasG12D/+ Rpl24Bst/+ colonic adenoma cultures (left) and quantification of the polysome to subpolysome ratio from these (right). Two biologically independent lines were analysed per genotype and plotted +/- standard error of the mean (SEM). Scheme above denotes the generation of adenoma cultures from distinct colonic tumours in aged VillinCreER Apcfl/+ KrasG12D/+ and VillinCreER Apcfl/+ KrasG12D/+ Rpl24Bst/+ mice. (C) Relative protein synthesis rates quantified by 35S-methionine incorporation in the colonic adenoma cultures described in (B) with n = 3. The average protein synthesis rates were plotted relative to Apcfl/+ KrasG12D/+ controls (=1) for three organoid lines per genotype +/- SEM. Significance was determined by Mann–Whitney U test. (D) 60S to 40S ratio from sucrose density gradients from lysates generated from the indicated genotypes. Data show the mean +/- SEM. Representative traces are shown in Figure 3B and Figure 4—figure supplement 2B. (E) Western blotting from protein lysates generated from three biologically independent organoid lines for each genotype. Mean values for RPL24, RPL10, RPL22, and RPS6 expression relative to beta -actin and P-eEF2 T56 relative to eEF2 are shown next to the relevant blot +/- SEM. The average of the VillinCreER Apcfl/+ KrasG12D/+ lanes in all cases has been set to 1. Image collected and cropped by CiteAb from the following open publication (https://elifesciences.org/articles/69729), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for RPL10 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50 - 1:200
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: RPL10
Alternate Names
60S ribosomal protein L10, DXS648EFLJ27072, DXS648FLJ23544, Laminin receptor homolog, NOV, Protein QM, QMDKFZp686J1851, ribosomal protein L10, Tumor suppressor QM, Wilms tumor-related protein
Gene Symbol
RPL10
Additional RPL10 Products
Product Documents for RPL10 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for RPL10 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for RPL10 Antibody - BSA Free
Customer Reviews for RPL10 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review RPL10 Antibody - BSA Free and earn rewards!
Have you used RPL10 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...