RTEL1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10036

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all RTEL1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RTEL1 (NP_057518.1). Peptide sequence HLNQGRPHLSPRPPPTGDPGSQPQWGSGVPRAGKQGQHAVSAYLADARRA

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

154 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for RTEL1 Antibody - BSA Free

Western Blot: RTEL1 Antibody [NBP3-10036]

Western Blot: RTEL1 Antibody [NBP3-10036]

Western Blot: RTEL1 Antibody [NBP3-10036] - Western blot analysis of RTEL1 in Human Lung Tumor lysates. Antibody dilution at 1ug/ml

Applications for RTEL1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RTEL1

In mice, inactivation of the Rtel (regulator of telomere length) gene has been shown to cause chromosome breaks, fusions, and telomere loss. In addition, Rtel is required for telomere elongation. Therefore, the mouse Rtel gene regulates chromosome stability and telomere length. This gene is the human ortholog of the mouse Rtel gene, so its protein product may play similar roles in humans. It is located in a gene-rich cluster on chromosome 20, with other potential tumor-related genes, such as TNFRSF6B. Multiple transcript variants encoding different isoforms have been described for this gene, although the full-length nature of not all variants is known. (provided by RefSeq)

Alternate Names

C20orf41, regulator of telomere elongation helicase 1, regulator of telomere length

Gene Symbol

RTEL1

Additional RTEL1 Products

Product Documents for RTEL1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RTEL1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RTEL1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RTEL1 Antibody - BSA Free and earn rewards!

Have you used RTEL1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies