SAMD4A Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57597

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SAMD4A Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to the middle region of SAMD4A(sterile alpha motif domain containing 4A). Peptide sequence LKSLRLHKYAALFSQMTYEEMMALTECQLEAQNVTKGARHKIVISIQKLK. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

79 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SAMD4A Antibody - BSA Free

Western Blot: SAMD4A Antibody [NBP1-57597]

Western Blot: SAMD4A Antibody [NBP1-57597]

Western Blot: SAMD4A Antibody [NBP1-57597] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.
Western Blot: SAMD4A Antibody [NBP1-57597]

Western Blot: SAMD4A Antibody [NBP1-57597]

Western Blot: SAMD4A Antibody [NBP1-57597] - Human Liver cell lysate, concentration 0.2-1 ug/ml.
Western Blot: SAMD4A Antibody [NBP1-57597]

Western Blot: SAMD4A Antibody [NBP1-57597]

Western Blot: SAMD4A Antibody [NBP1-57597] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

Applications for SAMD4A Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SAMD4A

Sterile alpha motifs (SAMs) in proteins such as SAMD4A are part of an RNA-binding domain that functions as a posttranscriptional regulator by binding to an RNA sequence motif known as the Smaug recognition element, which was named after the Drosophila Smaug protein.Sterile alpha motifs (SAMs) in proteins such as SAMD4A are part of an RNA-binding domain that functions as a posttranscriptional regulator by binding to an RNA sequence motif known as the Smaug recognition element, which was named after the Drosophila Smaug protein (Baez and Boccaccio, 2005 [PubMed 16221671]).

Alternate Names

DKFZp434H0350, DKFZp686A1532, hSmaug1DKFZP434H0350, KIAA1053SMAUG1, protein Smaug homolog 1, SAM domain-containing protein 4A, SAMD4, Smaug, Smaug 1, smaug homolog, Smaug1, SMG, SMGA, sterile alpha motif domain containing 4, sterile alpha motif domain containing 4A, Sterile alpha motif domain-containing protein 4A

Gene Symbol

SAMD4A

UniProt

Q9UPU9 (Human)

Additional SAMD4A Products

Product Documents for SAMD4A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SAMD4A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SAMD4A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SAMD4A Antibody - BSA Free and earn rewards!

Have you used SAMD4A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies