SAP30L Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP3-17535PEP

Novus Biologicals
100% Guarantee

Key Product Details

Source

E. coli

Applications

Antibody Competition
View all SAP30L Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SAP30L

Source: E. coli

Amino Acid Sequence: MNGFSTEEDSREGPPAAPAAAAPGYGQSCCLIE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17535.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP3-17535PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: SAP30L

SAP30L is a novel TGF- beta up-regulated mRNA species, the Sin3-associated protein 30-like, SAP30L has been identified. The predicted nuclear localization signal of SAP30L is sufficient for nuclear transport of the protein although mutating it does not completely remove SAP30L from the nuclei. By reason of its nuclear localization and close homology to SAP30 it is thought that SAP30L might have a role in recruiting the Sin3-histone deacetylase complex to specific co-repressor complexes in response to TGF-beta, leading to the silencing of proliferation-driving genes in the differentiating intestinal epithelial cells.

Alternate Names

DKFZp667L2214, FLJ11526, FLJ36497, HCV non-structural protein 4A-transactivated protein 2, histone deacetylase complex subunit SAP30L, NS4ATP2FLJ23595, SAP30-like, Sin3 corepressor complex subunit SAP30L, Sin3A associated protein p30-like, Sin3-associated protein p30-like

Gene Symbol

SAP30L

Additional SAP30L Products

Product Documents for SAP30L Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SAP30L Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for SAP30L Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review SAP30L Recombinant Protein Antigen and earn rewards!

Have you used SAP30L Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes