SCAMP3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56966

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SCAMP3 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MAQSRDGGNPFAEPSELDNPFQDPAVIQHRPSRQYATLDVYNPFETREPPPAYEP

Reactivity Notes

Mouse 87%, Rat 86%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SCAMP3 Antibody - BSA Free

Western Blot: SCAMP3 Antibody [NBP2-56966]

Western Blot: SCAMP3 Antibody [NBP2-56966]

Western Blot: SCAMP3 Antibody [NBP2-56966] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: SCAMP3 Antibody [NBP2-56966]

Immunocytochemistry/ Immunofluorescence: SCAMP3 Antibody [NBP2-56966]

Immunocytochemistry/Immunofluorescence: SCAMP3 Antibody [NBP2-56966] - Staining of human cell line U-2 OS shows localization to vesicles.

Applications for SCAMP3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SCAMP3

SCAMP3 product belongs to the SCAMP family of proteins which are secretory carrier membrane proteins. They function as carriers to the cell surface in post-golgi recycling pathways. Different family members are highly related products of distinct genes, and are usually expressed together. These findings suggest that the SCAMPs may function at the same site during vesicular transport rather than in separate pathways. Two transcript variants encoding different isoforms have been found for this gene.

Long Name

Secretory Carrier Membrane Protein 3

Alternate Names

PROPIN1

Gene Symbol

SCAMP3

Additional SCAMP3 Products

Product Documents for SCAMP3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SCAMP3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SCAMP3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SCAMP3 Antibody - BSA Free and earn rewards!

Have you used SCAMP3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies