SCN7A Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85697

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all SCN7A Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human SCN7A. Peptide sequence: PFIYGNLSQGMVSEPLEDVDPYYYKKKNTFIVLNKNRTIFRFNAASILCT The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SCN7A Antibody - BSA Free

Western Blot: SCN7A Antibody [NBP2-85697]

Western Blot: SCN7A Antibody [NBP2-85697]

Western Blot: SCN7A Antibody [NBP2-85697] - Host: Rabbit. Target Name: SCN7A. Sample Type: Fetal Thymus lysates. Antibody Dilution: 1.0ug/ml

Applications for SCN7A Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SCN7A

Voltage-dependent sodium channels mediate the sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, they form a sodium-selective channel through which Na(+) ions may pass in accordance with their electrochemical gradient. These ion channel proteins exist as heteromultimeric complexes of a large alpha subunit and 1 or 2 smaller beta subunits. SCN7A (Sodium channel protein type 7 subunit alpha) is an alpha subunit and is expressed in heart and uterus.

Alternate Names

Sodium channel protein cardiac and skeletal muscle subunit alpha, Sodium channel protein type VII subunit alpha, sodium channel, voltage-gated, type VI, alpha, sodium channel, voltage-gated, type VII, alpha, sodium channel, voltage-gated, type VII, alpha polypeptide, voltage-dependent sodium channel alpha subunit, voltage-gated, type VI, alpha polypeptide

Gene Symbol

SCN7A

Additional SCN7A Products

Product Documents for SCN7A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SCN7A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SCN7A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SCN7A Antibody - BSA Free and earn rewards!

Have you used SCN7A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies