SEC61A Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-86797
Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit
Format
BSA Free
Loading...
Product Specifications
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human SEC61A. Peptide sequence: TWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTAAAFGGLC The peptide sequence for this immunogen was taken from within the described region.
Specificity
This antibody made against SEC61A1 but the immunogen shows 98% sequence identity with human SEC61A2. Reactivity with SEC61A2 has not been determined experimentally.
Clonality
Polyclonal
Host
Rabbit
Scientific Data Images for SEC61A Antibody - BSA Free
Western Blot: SEC61A Antibody [NBP2-86797]
Western Blot: SEC61A Antibody [NBP2-86797] - Host: Rabbit. Target Name: SEC61A1. Sample Type: Human Fetal Lung. Antibody Dilution: 1.0ug/mlWestern Blot: SEC61A Antibody [NBP2-86797]
Western Blot: SEC61A Antibody [NBP2-86797] - WB Suggested Anti-SEC61A1 Antibody. Titration: 1.0 ug/ml. Positive Control: HT1080 Whole CellSEC61A1 is supported by BioGPS gene expression data to be expressed in HT1080Western Blot: SEC61A Antibody [NBP2-86797]
Western Blot: SEC61A Antibody [NBP2-86797] - Host: Rabbit. Target Name: SEC61A1. Sample Type: Human Adult Placenta. Antibody Dilution: 1.0ug/mlApplications for SEC61A Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: SEC61A
Alternate Names
HSEC61, protein transport protein SEC61 alpha subunit, protein transport protein Sec61 subunit alpha, protein transport protein Sec61 subunit alpha isoform 1, SEC61, Sec61 alpha 1 subunit (S. cerevisiae), Sec61 alpha-1, sec61 homolog, SEC61A
Gene Symbol
SEC61A1
Additional SEC61A Products
Product Documents for SEC61A Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for SEC61A Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for SEC61A Antibody - BSA Free
There are currently no reviews for this product. Be the first to review SEC61A Antibody - BSA Free and earn rewards!
Have you used SEC61A Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...