SERCA2 ATPase Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP2-34147PEP

Novus Biologicals
100% Guarantee

Key Product Details

Source

E. coli

Applications

Antibody Competition
View all SERCA2 ATPase Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ATP2A2.

Source: E. coli

Amino Acid Sequence: TVEEVLGHFGVNESTGLSLEQVKKLKERWGSNELPA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-34147.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP2-34147PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: SERCA2 ATPase

Sarcoplasmic/endoplasmic reticulum Calcium-ATPase 2 (SERCA2) is a magnesium-dependent pump that catalyzes the hydrolysis of ATP and translocates calcium from the cytosol to the sarcoplasmic reticulum lumen. There are 2 SERCA2 isoforms that differ in the 3' UTR. The SERCA2A isoform is highly expressed in heart and slow twitch skeletal muscle and is important to the regulation of the contraction and relaxation cycle, while the SERCA2B isoform is expressed in smooth muscle and adult epidermis. SERCA2 is also known as ATP2A2, ATP2B, DAR, DD, and MGC45367.

Long Name

Sarcoplasmic/endoplasmic reticulum calcium ATPase 2

Alternate Names

ATP2A2, ATP2B, Calcium pump 2, SERCA2, SR Ca(2+)-ATPase 2

Gene Symbol

ATP2A2

Additional SERCA2 ATPase Products

Product Documents for SERCA2 ATPase Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SERCA2 ATPase Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for SERCA2 ATPase Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review SERCA2 ATPase Recombinant Protein Antigen and earn rewards!

Have you used SERCA2 ATPase Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes