SIAH2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85729

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all SIAH2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SIAH2. Peptide sequence: AVDWVMMQSCFGHHFMLVLEKQEKYEGHQQFFAIVLLIGTRKQAENFAYR The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SIAH2 Antibody - BSA Free

Western Blot: SIAH2 Antibody [NBP2-85729]

Western Blot: SIAH2 Antibody [NBP2-85729]

Western Blot: SIAH2 Antibody [NBP2-85729] - WB Suggested Anti-SIAH2 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Human Muscle
Western Blot: SIAH2 Antibody [NBP2-85729]

Western Blot: SIAH2 Antibody [NBP2-85729]

Western Blot: SIAH2 Antibody [NBP2-85729] - Host: Rabbit. Target Name: SIAH2. Sample Type: 721_B. Antibody Dilution: 1.0ug/mlSIAH2 is supported by BioGPS gene expression data to be expressed in 721_B

Applications for SIAH2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SIAH2

The Drosophila SINA (seven in absentia) protein is an E3 ubiquitin ligase component of the RAS signal transduction pathway. The RAS signal pathway controls cell proliferation, differentiation, and survival, and regulation of this pathway is critical for normal development. In Drosophila, SINA serves as a downstream gatekeeper required for proper RAS signal transduction. Similarly to SINA in Drosophila, the human protein SIAH has also been shown to be required for oncogenic RAS signaling in cancer.

Alternate Names

E3 ubiquitin-protein ligase SIAH2, EC 6.3.2, EC 6.3.2.-, hSiah2, seven in absentia (Drosophila) homolog 2, Seven in absentia homolog 2, seven in absentia homolog 2 (Drosophila), Siah-2

Gene Symbol

SIAH2

Additional SIAH2 Products

Product Documents for SIAH2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SIAH2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SIAH2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SIAH2 Antibody - BSA Free and earn rewards!

Have you used SIAH2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies