SIAH3 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-83524
Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit
Format
BSA Free
Loading...
Product Specifications
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human SIAH3. Peptide sequence: PAPADWIIMHSCLGHHFLLVLRKQERHEGHPQFFATMMLIGTPTQADCFT The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Scientific Data Images for SIAH3 Antibody - BSA Free
Western Blot: SIAH3 Antibody [NBP2-83524]
Western Blot: SIAH3 Antibody [NBP2-83524] - Host: Rabbit. Target Name: SIAH3. Sample Type: MCF7 Whole Cell lysates. Antibody Dilution: 1.0ug/mlWestern Blot: SIAH3 Antibody - BSA Free [NBP2-83524] -
Melatonin injection ameliorates fibrotic CKD and improves kidney function in a CKD mouse model via miR-4516/SIAH3/PINK1 pathway. (A) miR-4516 expression level in renal cortex of healthy kidney control and CKD mice either treated with melatonin, or both melatonin and miR-4516 inhibitor, measured by qRT-PCR (n = 3). (B) Expression of SIAH3 and PINK1 in renal cortex of each groups. Protein expression level was quantified by densitometry and normalized to alpha -tubulin levels (n = 3). (C) IHC staining for SIAH3 in renal cortex of each mouse group. (D) H&E staining of renal cortex of each mouse group. (E,F) Measurement of blood urea nitrogen (E) and creatinine (F) level in serum of each mouse group (n = 5). The values represent mean +/- SEM, * p < 0.05, ** p < 0.01 versus healthy kidney control; #p < 0.05, ##p < 0.01 versus PBS; $p < 0.05, $$p < 0.01 versus melatonin. The alpha -tubulin was used as Western blot loading control for whole tissue lysates. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/34359852), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for SIAH3 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: SIAH3
Alternate Names
Seven In Absentia Homolog 3, Seven In Absentia Homolog 3 (Drosophila), Siah E3 Ubiquitin Protein Ligase Family Member 3, siah-3
Gene Symbol
SIAH3
Additional SIAH3 Products
Product Documents for SIAH3 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for SIAH3 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for SIAH3 Antibody - BSA Free
Customer Reviews for SIAH3 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review SIAH3 Antibody - BSA Free and earn rewards!
Have you used SIAH3 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...