SIAH3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83524

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SIAH3. Peptide sequence: PAPADWIIMHSCLGHHFLLVLRKQERHEGHPQFFATMMLIGTPTQADCFT The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SIAH3 Antibody - BSA Free

Western Blot: SIAH3 Antibody [NBP2-83524]

Western Blot: SIAH3 Antibody [NBP2-83524]

Western Blot: SIAH3 Antibody [NBP2-83524] - Host: Rabbit. Target Name: SIAH3. Sample Type: MCF7 Whole Cell lysates. Antibody Dilution: 1.0ug/ml
SIAH3 Antibody - BSA Free

Western Blot: SIAH3 Antibody - BSA Free [NBP2-83524] -

Melatonin injection ameliorates fibrotic CKD and improves kidney function in a CKD mouse model via miR-4516/SIAH3/PINK1 pathway. (A) miR-4516 expression level in renal cortex of healthy kidney control and CKD mice either treated with melatonin, or both melatonin and miR-4516 inhibitor, measured by qRT-PCR (n = 3). (B) Expression of SIAH3 and PINK1 in renal cortex of each groups. Protein expression level was quantified by densitometry and normalized to alpha -tubulin levels (n = 3). (C) IHC staining for SIAH3 in renal cortex of each mouse group. (D) H&E staining of renal cortex of each mouse group. (E,F) Measurement of blood urea nitrogen (E) and creatinine (F) level in serum of each mouse group (n = 5). The values represent mean +/- SEM, * p < 0.05, ** p < 0.01 versus healthy kidney control; #p < 0.05, ##p < 0.01 versus PBS; $p < 0.05, $$p < 0.01 versus melatonin. The alpha -tubulin was used as Western blot loading control for whole tissue lysates. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/34359852), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for SIAH3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SIAH3

Alternate Names

Seven In Absentia Homolog 3, Seven In Absentia Homolog 3 (Drosophila), Siah E3 Ubiquitin Protein Ligase Family Member 3, siah-3

Gene Symbol

SIAH3

Additional SIAH3 Products

Product Documents for SIAH3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SIAH3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for SIAH3 Antibody - BSA Free

Customer Reviews for SIAH3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SIAH3 Antibody - BSA Free and earn rewards!

Have you used SIAH3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...