SIDT2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-91551

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SIDT2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human SIDT2. Peptide sequence LNKQKGAPLLFVVRQKEAVVSFQVPLILRGMFQRKYLYQKVERTLCQPPT. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SIDT2 Antibody - BSA Free

Western Blot: SIDT2 Antibody [NBP1-91551]

Western Blot: SIDT2 Antibody [NBP1-91551]

Western Blot: SIDT2 Antibody [NBP1-91551] - Host: Rabbit. Target Name: SIDT2. Sample Tissue: Human HepG2 Whole Cell. Antibody Dilution: 1ug/ml
Western Blot: SIDT2 Antibody [NBP1-91551]

Western Blot: SIDT2 Antibody [NBP1-91551]

Western Blot: SIDT2 Antibody [NBP1-91551] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.
Western Blot: SIDT2 Antibody [NBP1-91551]

Western Blot: SIDT2 Antibody [NBP1-91551]

Western Blot: SIDT2 Antibody [NBP1-91551] - Sample Type: HepG2 Antibody Dilution: 1.0 ug/ml SIDT2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells
Western Blot: SIDT2 Antibody [NBP1-91551]

Western Blot: SIDT2 Antibody [NBP1-91551]

Western Blot: SIDT2 Antibody [NBP1-91551] - Sample Type: Human Fetal Brain Antibody Dilution: 1.0 ug/ml
Western Blot: SIDT2 Antibody [NBP1-91551]

Western Blot: SIDT2 Antibody [NBP1-91551]

Western Blot: SIDT2 Antibody [NBP1-91551] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml
Western Blot: SIDT2 Antibody [NBP1-91551]

Western Blot: SIDT2 Antibody [NBP1-91551]

Western Blot: SIDT2 Antibody [NBP1-91551] - Sample Tissue: Human Fetal Liver Antibody Dilution: 1.0 ug/ml
Western Blot: SIDT2 Antibody [NBP1-91551]

Western Blot: SIDT2 Antibody [NBP1-91551]

Western Blot: SIDT2 Antibody [NBP1-91551] - Sample Type: 721_B Antibody Dilution: 1.0 ug/ml SIDT2 is supported by BioGPS gene expression data to be expressed in 721_B

Applications for SIDT2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SIDT2

Alternate Names

DKFZp686L17253, FLJ90656, SID1 transmembrane family member 2, SID1 transmembrane family, member 2, UNQ685/PRO1325

Gene Symbol

SIDT2

UniProt

NP_001035545 (Human)

Additional SIDT2 Products

Product Documents for SIDT2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SIDT2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SIDT2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SIDT2 Antibody - BSA Free and earn rewards!

Have you used SIDT2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies