Sin3A-associated protein Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84262

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Sin3A-associated protein Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human Sin3A-associated protein. Peptide sequence: ANNLSMPTSDLPPGASPRKKPRKQQHVISTEEGDMMETNSTDDEKSTAKS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Sin3A-associated protein Antibody - BSA Free

Western Blot: Sin3A-associated protein Antibody [NBP2-84262]

Western Blot: Sin3A-associated protein Antibody [NBP2-84262]

Western Blot: Sin3A-associated protein Antibody [NBP2-84262] - Host: Rabbit. Target Name: SAP130. Sample Type: Jurkat Whole Cell lysates. Antibody Dilution: 1.0ug/mlSAP130 is supported by BioGPS gene expression data to be expressed in Jurkat

Applications for Sin3A-associated protein Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Sin3A-associated protein

Pyruvate dehydrogenase (E1) is one of the three components (E1, E2, and E3) of the large pyruvate dehydrogenase complex. Pyruvate Sin3A-associated protein is a subunit of the histone deacetylase (see HDAC1; MIM 601241)-dependent SIN3A (MIM 607776) corepressor complex (Fleischer et al., 2003 [PubMed 12724404]).[supplied by OMIM, Mar 2008]

Alternate Names

130 kDa Sin3-associated polypeptide, histone deacetylase complex subunit SAP130, mSin3A-associated protein 130, SAP130, SAP130 Sin3A-associated protein, 130kDa, Sin3-associated polypeptide p130

Gene Symbol

SAP130

Additional Sin3A-associated protein Products

Product Documents for Sin3A-associated protein Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Sin3A-associated protein Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Sin3A-associated protein Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Sin3A-associated protein Antibody - BSA Free and earn rewards!

Have you used Sin3A-associated protein Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies