SIX2 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-94801

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 120-174 of human SIX2 (NP_058628.3). SIWDGEETSYCFKEKSRSVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit SIX2 Antibody - Azide and BSA Free (NBP2-94801) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for SIX2 Antibody - Azide and BSA Free

Western Blot: SIX2 AntibodyAzide and BSA Free [NBP2-94801]

Western Blot: SIX2 AntibodyAzide and BSA Free [NBP2-94801]

Western Blot: SIX2 Antibody [NBP2-94801] - Western blot analysis of extracts of various cell lines, using SIX2 antibody (NBP2-94801) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Western Blot: SIX2 AntibodyAzide and BSA Free [NBP2-94801]

Western Blot: SIX2 AntibodyAzide and BSA Free [NBP2-94801]

Western Blot: SIX2 Antibody [NBP2-94801] - Western blot analysis of extracts of Rat skeletal muscle cells, using SIX2 antibody (NBP2-94801) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

Applications for SIX2 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SIX2

The SIX2 gene is a member of the vertebrate gene family which encode proteins homologous to the Drosophila 'sine oculis' homeobox protein. The encoded protein is a transcription factor which, like other members of this gene family, may be involved in limb or

Alternate Names

homeobox protein SIX2, sine oculis homeobox (Drosophila) homolog 2, Sine oculis homeobox homolog 2, sine oculis homeobox homolog 2 (Drosophila), SIX homeobox 2

Gene Symbol

SIX2

Additional SIX2 Products

Product Documents for SIX2 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SIX2 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for SIX2 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review SIX2 Antibody - Azide and BSA Free and earn rewards!

Have you used SIX2 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...