SLC25A11 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59596

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SLC25A11 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to SLC25A11(solute carrier family 25 (mitochondrial carrier; oxoglutarate carrier), member 11) The peptide sequence was selected from the N terminal of SLC25A11. Peptide sequence AATASAGAGGIDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SLC25A11 Antibody - BSA Free

Western Blot: SLC25A11 Antibody [NBP1-59596]

Western Blot: SLC25A11 Antibody [NBP1-59596]

Western Blot: SLC25A11 Antibody [NBP1-59596] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.

Applications for SLC25A11 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC25A11

SLC25A11 catalyzes the transport of 2-oxoglutarate across the inner mitochondrial membrane in an electroneutral exchange for malate or other dicarboxylic acids, and plays an important role in several metabolic processes, including the malate-aspartate shuttle, the oxoglutarate/isocitrate shuttle, in gluconeogenesis from lactate, and in nitrogen metabolism.

Alternate Names

OGCmitochondrial 2-oxoglutarate/malate carrier protein, OGCP, SLC20A4solute carrier family 20 (oxoglutarate carrier), member 4, solute carrier family 25 (mitochondrial carrier; oxoglutarate carrier), member11, Solute carrier family 25 member 11

Gene Symbol

SLC25A11

UniProt

Q02978 (Human)

Additional SLC25A11 Products

Product Documents for SLC25A11 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SLC25A11 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC25A11 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC25A11 Antibody - BSA Free and earn rewards!

Have you used SLC25A11 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies