SLC25A15 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85739

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all SLC25A15 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of SLC25A15. Peptide sequence: GTACVLTGQPFDTMKVKMQTFPDLYRGLTDCCLKTYSQVGFRGFYKGTSP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SLC25A15 Antibody - BSA Free

Western Blot: SLC25A15 Antibody [NBP2-85739]

Western Blot: SLC25A15 Antibody [NBP2-85739]

Western Blot: SLC25A15 Antibody [NBP2-85739] - WB Suggested Anti-Slc25a15 Antibody. Titration: 1.0 ug/ml. Positive Control: Mouse Pancreas

Applications for SLC25A15 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC25A15

The SLC25A15 gene is a member of the mitochondrial carrier family. The encoded protein transports ornithine across the inner mitochondrial membrane from the cytosol to the mitochondrial matrix. The protein is an essential component of the urea cycle, and function

Alternate Names

D13S327, mitochondrial ornithine transporter 1, ORC1, ornithine transporter 1, ORNT1HHH, solute carrier family 25 (mitochondrial carrier; ornithine transporter) member15, Solute carrier family 25 member 15

Gene Symbol

SLC25A15

Additional SLC25A15 Products

Product Documents for SLC25A15 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SLC25A15 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC25A15 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC25A15 Antibody - BSA Free and earn rewards!

Have you used SLC25A15 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies