SLC4A4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88308

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all SLC4A4 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human SLC4A4. Peptide sequence: AVLDRGASFLKHVCDEEEVEGHHTIYIGVHVPKSYRRRRRHKRKTGHKEK The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SLC4A4 Antibody - BSA Free

Western Blot: SLC4A4 Antibody [NBP2-88308]

Western Blot: SLC4A4 Antibody [NBP2-88308]

Western Blot: SLC4A4 Antibody [NBP2-88308] - Host: Rabbit. Target Name: SLC4A4. Sample Tissue: Human PANC1 Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for SLC4A4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC4A4

SLC4A4 - solute carrier family 4, sodium bicarbonate cotransporter, member 4

Alternate Names

electrogenic sodium bicarbonate cotransporter 1, hhNMC, HNBC1, KNBC, kNBC1, Na(+)/HCO3(-) cotransporter, NBC, NBC1DKFZp781H1314, NBC2, NBCE1, pNBC, SLC4A5, Sodium bicarbonate cotransporter, sodium bicarbonate cotransporter 1 (sodium bicarbonate cotransporter, kidney;sodium bicarbonate cotransporter, pancreas), Solute carrier family 4 member 4, solute carrier family 4, sodium bicarbonate cotransporter, member 4, solute carrier family 4, sodium bicarbonate cotransporter, member 4, brain type, solute carrier family 4, sodium bicarbonate cotransporter, member 5

Gene Symbol

SLC4A4

Additional SLC4A4 Products

Product Documents for SLC4A4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SLC4A4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC4A4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC4A4 Antibody - BSA Free and earn rewards!

Have you used SLC4A4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for SLC4A4 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All

  • Q: Have any of your SLC4A4 antibodies been tested for use in IHC?

    A: The SLC4A4 antibodies have not been tested, or validated in IHC at this time. We will guarantee all listed applications and species. Should you wish to test in this new application, we would recommend our Innovators Reward Program. Under the terms of this program, you are eligible for a full credit of the price of this antibody in exchange for your data on IHC use. Eligibility for the credit is regardless of positive or negative results, as the data is still useful.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies