SLC4A5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84267

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all SLC4A5 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human SLC4A5. Peptide sequence: RWSKPHVSTLSLHSLFELRTCLQTGTVLLDLDSGSLPQIIDDVIEKQIED The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SLC4A5 Antibody - BSA Free

Western Blot: SLC4A5 Antibody [NBP2-84267]

Western Blot: SLC4A5 Antibody [NBP2-84267]

Western Blot: SLC4A5 Antibody [NBP2-84267] - WB Suggested Anti-SLC4A5 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:12500. Positive Control: HepG2 cell lysate

Applications for SLC4A5 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC4A5

The SLC4A5 gene encodes a member of the sodium bicarbonate cotransporter (NBC) family, part of the bicarbonate transporter superfamily. Sodium bicarbonate cotransporters are involved in intracellular pH regulation and electroneural or electrogenic sodium bicarb

Alternate Names

electrogenic sodium bicarbonate cotransporter 4, MGC129662, NBC4Solute carrier family 4 member 5, NBCe2, solute carrier family 4, sodium bicarbonate cotransporter, member 5

Gene Symbol

SLC4A5

Additional SLC4A5 Products

Product Documents for SLC4A5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SLC4A5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC4A5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC4A5 Antibody - BSA Free and earn rewards!

Have you used SLC4A5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies