SLC6A15 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-59366
Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Synthetic peptides corresponding to SLC6A15(solute carrier family 6, member 15) The peptide sequence was selected from the N terminal of SLC6A15.
Peptide sequence DQCPLVKNASHTFVEPECEQSSATTYYWYREALNISSSISESGGLNWKMT. The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
82 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for SLC6A15 Antibody - BSA Free
Western Blot: SLC6A15 Antibody [NBP1-59366]
Western Blot: SLC6A15 Antibody [NBP1-59366] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.Applications for SLC6A15 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: SLC6A15
Alternate Names
B0AT2, DKFZp761I0921, FLJ10316, homolog of rat orphan transporter v7-3, hv7-3, MGC87066, NTT73orphan sodium- and chloride-dependent neurotransmitter transporter NTT73, orphan transporter v7-3, SBAT1, Sodium- and chloride-dependent neurotransmitter transporter NTT73, sodium/chloride dependent neurotransmitter transporter Homo sapiens orphanneurotransmitter transporter NTT7, Sodium-coupled branched-chain amino-acid transporter 1, solute carrier family 6 (neurotransmitter transporter), member 15, solute carrier family 6 (neutral amino acid transporter), member 15, Solute carrier family 6 member 15, solute carrier family 6, member 15, Transporter v7-3, V7-3
Gene Symbol
SLC6A15
UniProt
Additional SLC6A15 Products
Product Documents for SLC6A15 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for SLC6A15 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for SLC6A15 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review SLC6A15 Antibody - BSA Free and earn rewards!
Have you used SLC6A15 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...