SLITRK3 is a transmembrane protein that is expressed in multiple regions of the brain, particularly the cerebral cortex and hippocampus. SLITRK3 can suppress neurite outgrowth and promote the formation of inhibitory presynaptic structures. It localizes post-synaptically and binds to PTP-delta and PTP-sigma on pre-synaptic inhibitory terminals. SLITRK3 is upregulated during the development of gastrointestinal stromal tumors.
SLITRK3 Recombinant Protein Antigen
Novus Biologicals | Catalog # NBP2-62616PEP
Loading...
Key Product Details
Source
E. coli
Applications
Antibody Competition
Loading...
Product Specifications
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLITRK3.
Source: E. coli
Amino Acid Sequence: EEVAVSSAQEAGSAERGGPGTQPPGMGEALLGSEQFAETPKENHSNYRTLLEKEKEWALAVSSSQLNTIVTVNHHHPHHPAVGGVSGVVGGTGGDLAGFRHHEKNGGVVLFPPGGGCGSGSMLLDRERPQPAPCTVGFVDCLY
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Purity
>80% by SDS-PAGE and Coomassie blue staining
Predicted Molecular Mass
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Applications
Antibody Competition (10-100 molar excess)
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-62616.
It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.
For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Protein / Peptide Type
Recombinant Protein Antigen
Formulation, Preparation, and Storage
NBP2-62616PEP
| Formulation | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: SLITRK3
Long Name
SLIT and NTRK-like Family, Member 3
Alternate Names
MGC138681, SLIT and NTRK-like family, member 3
Gene Symbol
SLITRK3
Additional SLITRK3 Products
Product Documents for SLITRK3 Recombinant Protein Antigen
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for SLITRK3 Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Customer Reviews for SLITRK3 Recombinant Protein Antigen
There are currently no reviews for this product. Be the first to review SLITRK3 Recombinant Protein Antigen and earn rewards!
Have you used SLITRK3 Recombinant Protein Antigen?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Loading...